DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10257 and Faim

DIOPT Version :9

Sequence 1:NP_611008.2 Gene:CG10257 / 36671 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001116323.1 Gene:Faim / 23873 MGIID:1344387 Length:201 Species:Mus musculus


Alignment Length:196 Identity:71/196 - (36%)
Similarity:118/196 - (60%) Gaps:7/196 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PTMTQDHVPEDQRYNKQNIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVG 81
            |....|..|........::||.|.|.::..:::||.|||||||:|:::|:|:|.:||:|||||||
Mouse     8 PIFEDDESPLYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVG 72

  Fly    82 EDTFHID--QTRCIIRVDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYR 144
            ::||.:.  :|:..|.:|...||.|||:|.|||||..:|.|:.::....|:...|.     ::.|
Mouse    73 KETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRLDG-----EDLR 132

  Fly   145 IMLKLDTLSLYVNDELRTEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVP 209
            ::|:.||:.::.|.:.......||..||:|.|.:.:....::|.|||.:.:||:|||:.:...:|
Mouse   133 VVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIP 197

  Fly   210 E 210
            |
Mouse   198 E 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 66/175 (38%)
FaimNP_001116323.1 FAIM1 24..198 CDD:399710 66/178 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840842
Domainoid 1 1.000 140 1.000 Domainoid score I4740
eggNOG 1 0.900 - - E1_KOG4352
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8018
Inparanoid 1 1.050 140 1.000 Inparanoid score I4485
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48789
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003977
OrthoInspector 1 1.000 - - otm43173
orthoMCL 1 0.900 - - OOG6_107504
Panther 1 1.100 - - LDO PTHR13088
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3445
SonicParanoid 1 1.000 - - X2734
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.