DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and Faim

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001116323.1 Gene:Faim MGIID:1344387 Length:201 Species:Mus musculus

Alignment Length:196 Identity:71/197 (36%)
Similarity:118/197 (60%) Gaps:7/197 (4%)


  Fly    17 PTMTQDHVPEDQRYNKQNIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVG 81
            |....|..|........::||.|.|.::..:::||.|||||||:|:::|:|:|.:||:|||||||
Mouse     8 PIFEDDESPLYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVG 72

  Fly    82 EDTFHID--QTRCIIRVDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYR 144
            ::||.:.  :|:..|.:|...||.|||:|.|||||..:|.|:.::....|:...|.     ::.|
Mouse    73 KETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTSTWVLRLDG-----EDLR 132

  Fly   145 IMLKLDTLSLYVNDELRTEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVP 209
            ::|:.||:.::.|.:.......||..||:|.|.:.:....::|.|||.:.:||:|||:.:...:|
Mouse   133 VVLEKDTMDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIP 197

  Fly   210 E 210
            |
Mouse   198 E 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 66/176 (38%)
FaimNP_001116323.1 FAIM1 25..196 CDD:284354 66/176 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166857694
eggNOG 1 0.900 E1_KOG4352
Hieranoid 1 1.000
Homologene 1 1.000 H8018
Inparanoid 1 1.050 140 1.000 Inparanoid score I4453
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 1 1.000 T616216
orthoMCL 1 0.900 OOG5_134100
Panther 1 1.100 LDO PTHR13088
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3445
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.