DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and R148.5

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497665.2 Gene:R148.5 WormBaseID:WBGene00020104 Length:528 Species:Caenorhabditis elegans

Alignment Length:77 Identity:18/78 (23%)
Similarity:26/78 (33%) Gaps:24/78 (31%)


  Fly   155 YVNDELRTEESVF----VH---------------GGTDTKFLLQDTEFVLQARSSGNKHDGIVHT 200
            |:..|.:||...|    :|               ||...:|:..|:.|   |....:.|..|...
 Worm    62 YIEGEKKTETVFFPIITLHYCAAVRYVNVEGFKVGGGGEQFMPLDSPF---ANIPNSPHPPIFAA 123

  Fly   201 LL--ANGVAVPE 210
            :.  ..||.|.|
 Worm   124 IFRRTTGVKVLE 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 16/74 (22%)
R148.5NP_497665.2 PTB_CG12581 1..166 CDD:241252 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4352
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.