DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and C44B11.1

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497664.2 Gene:C44B11.1 WormBaseID:WBGene00016633 Length:190 Species:Caenorhabditis elegans

Alignment Length:176 Identity:67/177 (38%)
Similarity:107/177 (60%) Gaps:5/177 (3%)


  Fly    34 NIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVGEDTFHIDQTRCIIRVDP 98
            ::||.|.||::.::::||.|||||:|:|:|.::|.|:|||||||||||::.|.:...:|||.|:.
 Worm     5 DVVATWNVPLHAQVHKIEFEHGTTTGKRVIRIDGNEILRRDWMFKLVGKEAFKVGDMKCIINVEA 69

  Fly    99 APGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYRIMLKLDTLSLYVNDELRTE 163
            ...|.|||||.::||:.:::.|:..::...|..|...     .::|::|..:::.::.|......
 Worm    70 LGTFAYEYSLDVNGKTFNKFKEEQNKRLHSWETTLSG-----HQWRVVLDKESMEIWANGNNIDT 129

  Fly   164 ESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVP 209
            ...||..||.|.|.|......:.|:|||.|..|:.|||..||..||
 Worm   130 AGEFVDNGTVTHFELGKNPCKIIAQSSGKKKTGVTHTLYVNGEIVP 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 65/174 (37%)
C44B11.1NP_497664.2 FAIM1 5..174 CDD:284354 65/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166855319
eggNOG 1 0.900 E1_KOG4352
Hieranoid 1 1.000
Homologene 1 1.000 H8018
Inparanoid 1 1.050 139 1.000 Inparanoid score I3044
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1301275at2759
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 1 1.000 T475481
orthoMCL 1 0.900 OOG5_134100
Panther 1 1.100 LDO PTHR13088
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3445
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.