DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10257 and C44B11.1

DIOPT Version :9

Sequence 1:NP_611008.2 Gene:CG10257 / 36671 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497664.2 Gene:C44B11.1 / 175421 WormBaseID:WBGene00016633 Length:190 Species:Caenorhabditis elegans


Alignment Length:176 Identity:67/176 - (38%)
Similarity:107/176 - (60%) Gaps:5/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVGEDTFHIDQTRCIIRVDP 98
            ::||.|.||::.::::||.|||||:|:|:|.::|.|:|||||||||||::.|.:...:|||.|:.
 Worm     5 DVVATWNVPLHAQVHKIEFEHGTTTGKRVIRIDGNEILRRDWMFKLVGKEAFKVGDMKCIINVEA 69

  Fly    99 APGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYRIMLKLDTLSLYVNDELRTE 163
            ...|.|||||.::||:.:::.|:..::...|..|...     .::|::|..:::.::.|......
 Worm    70 LGTFAYEYSLDVNGKTFNKFKEEQNKRLHSWETTLSG-----HQWRVVLDKESMEIWANGNNIDT 129

  Fly   164 ESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVP 209
            ...||..||.|.|.|......:.|:|||.|..|:.|||..||..||
 Worm   130 AGEFVDNGTVTHFELGKNPCKIIAQSSGKKKTGVTHTLYVNGEIVP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 65/173 (38%)
C44B11.1NP_497664.2 FAIM1 5..174 CDD:284354 65/173 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161694
Domainoid 1 1.000 139 1.000 Domainoid score I2990
eggNOG 1 0.900 - - E1_KOG4352
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8018
Inparanoid 1 1.050 139 1.000 Inparanoid score I3091
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48789
OrthoDB 1 1.010 - - D1301275at2759
OrthoFinder 1 1.000 - - FOG0003977
OrthoInspector 1 1.000 - - oto17292
orthoMCL 1 0.900 - - OOG6_107504
Panther 1 1.100 - - LDO PTHR13088
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3445
SonicParanoid 1 1.000 - - X2734
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.