DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10257 and LOC100362113

Sequence 1:NP_611008.2 Gene:CG10257 FlyBaseID:FBgn0033985 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_002730005.1 Gene:LOC100362113 RGDID:2318770 Length:201 Species:Rattus norvegicus

Alignment Length:196 Identity:72/197 (37%)
Similarity:119/197 (60%) Gaps:7/197 (4%)


  Fly    17 PTMTQDHVPEDQRYNKQNIVAQWCVPINGKMYRIELEHGTTSGRRMIWVNGREVLRRDWMFKLVG 81
            |....|..|........::||.|.|.::..:::||.|||||||:|:::|:|:|.:||:|||||||
  Rat     8 PIFEDDESPLCSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRREWMFKLVG 72

  Fly    82 EDTFHID--QTRCIIRVDPAPGFKYEYSLYIDGKSHDQYTEDMTRQYRLWLYTDDAAADAPQEYR 144
            ::||.:.  :|:..|.:|...||.|||:|.|||||..:|.|:.::....|:...|.     :|.|
  Rat    73 KETFFVGAAKTKATINIDAISGFAYEYTLEIDGKSLKKYMENRSKTTNTWVLHLDG-----EELR 132

  Fly   145 IMLKLDTLSLYVNDELRTEESVFVHGGTDTKFLLQDTEFVLQARSSGNKHDGIVHTLLANGVAVP 209
            ::|:.||:.::.|.:.......||..||:|.|.:.:.:..::|.|||.:.:||:|||:.:...:|
  Rat   133 VVLEKDTMDVWCNGQRMETAGEFVDDGTETHFSVGNHDCYIKAVSSGKRREGIIHTLIVDNREIP 197

  Fly   210 E 210
            |
  Rat   198 E 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10257NP_611008.2 FAIM1 34..208 CDD:284354 67/176 (38%)
LOC100362113XP_002730005.1 FAIM1 25..196 CDD:284354 67/176 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166857683
eggNOG 1 0.900 E1_KOG4352
Hieranoid 1 1.000
Homologene 1 1.000 H8018
Inparanoid 1 1.050 145 1.000 Inparanoid score I4276
OMA 1 1.010
OrthoDB 1 1.010 D1301275at2759
OrthoFinder 1 1.000 FOG0002729
OrthoInspector 1 1.000 T618338
orthoMCL 1 0.900 OOG5_134100
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.670

Return to query results.
Submit another query.