DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and CYR1

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_012529.3 Gene:CYR1 SGDID:S000003542 Length:2026 Species:Saccharomyces cerevisiae

Alignment Length:1053 Identity:223/1054 (21%)
Similarity:347/1054 (33%) Gaps:333/1054 (32%)


  Fly     9 PCFKFKREEVIDKLDYSNT-----PL-------------------TDFPEVWQHERTLEELYLST 49
            |...::....|:.||.||.     ||                   :.||........|..|.|..
Yeast   808 PIIFYQHTSEIESLDVSNNANIFLPLEFIESSIKLLSLRMVNIRASKFPSNITKAYKLVSLELQR 872

  Fly    50 TRLQALPPQLFYCQGLRVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHL 114
            ..::.:|..:.....|.:|::..|.|||:|.....|:.||.|||:.|..::.||.|..|.:|..:
Yeast   873 NFIRKVPNSIMKLSNLTILNLQCNELESLPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQI 937

  Fly   115 DLSCNSLQRLPDAITSLISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLIN 179
            |||.|.:|.||.:...|:.|.::.|:...|.|: .:...:.:||.|.||.|.:.::   .....|
Yeast   938 DLSYNKIQSLPQSTKYLVKLAKMNLSHNKLNFI-GDLSEMTDLRTLNLRYNRISSI---KTNASN 998

  Fly   180 LQRLDIGGNEFTELPEVVGELKSLRELWIDFNQIRRVSAN------------------------I 220
            ||.|.:..|..:...:.   |..||.|.|..|.|..:|..                        :
Yeast   999 LQNLFLTDNRISNFEDT---LPKLRALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELL 1060

  Fly   221 GKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSVGMLKSLVTFKCESNGLTEL 285
            .||..|:..|.|.|.|..||.|:|....:..||:..|.||..|..:..||||.|....||.:.:.
Yeast  1061 TKLSFLEKLELNQNNLTRLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDF 1125

  Fly   286 PD--------------------------------------------------------------- 287
            .|                                                               
Yeast  1126 VDGMENLELTSLNISSNAFGNSSLENSFYHNMSYGSKLSKSLMFFIAADNQFDDAMWPLFNCFVN 1190

  Fly   288 ----SISY----------LEQLEELVLSHNKLIRLP-STIGMLRSLRFLFADDNQLRQLPDELCS 337
                ::||          ||.:.||.||.|||..|. .|:....||:.|..:.||:..||.||.:
Yeast  1191 LKVLNLSYNNFSDVSHMKLESITELYLSGNKLTTLSGDTVLKWSSLKTLMLNSNQMLSLPAELSN 1255

  Fly   338 CQQLSVLSVANNQLSALPQNIGNL---------SKMKVLNVVNNY------------------IN 375
            ..||||..|..|||.   .||.|.         .::|.||...|.                  :.
Yeast  1256 LSQLSVFDVGANQLK---YNISNYHYDWNWRNNKELKYLNFSGNRRFEIKSFISHDIDADLSDLT 1317

  Fly   376 ALPVSMLNLVNLTSMWLSDNQSQPLVPLQYLDASTKTQLTCFMLPQVTFKMNSIQ---AQQQAQE 437
            .||  .|.::.|..:.|:..:    ||.:.::         |.|......:|.::   |....|.
Yeast  1318 VLP--QLKVLGLMDVTLNTTK----VPDENVN---------FRLRTTASIINGMRYGVADTLGQR 1367

  Fly   438 QYEFVYANQQQPHASPSRRICFA------EEATI-LSNAKAQPAPNYPSFVAAPPTPTPDQMAGS 495
            .|            ..||.:.|.      :|..: |.::|.|.| :|...::             
Yeast  1368 DY------------VSSRDVTFERFRGNDDECLLCLHDSKNQNA-DYGHNIS------------- 1406

  Fly   496 VRLMRSPTPYPKEL-RQMSKYVRQAQAATSSANASEVREARVVTNGQIHCDSNNANQDVVDQATT 559
             |::|.  .|.|.| ||:.:|..:......:|......:.....||.::...|.|  ||.:.:..
Yeast  1407 -RIVRD--IYDKILIRQLERYGDETDDNIKTALRFSFLQLNKEINGMLNSVDNGA--DVANLSYA 1466

  Fly   560 SAIYGIAPETTHIYGVYQQPQQMAHPVPTQEYYGLPLVNYEAHYQQLYVEANTPLPTTHLNGDQD 624
            ..:.|......:|.|              ::.:...|.:..|     .:..|        |||  
Yeast  1467 DLLSGACSTVIYIRG--------------KKLFAANLGDCMA-----ILSKN--------NGD-- 1502

  Fly   625 YELQPLQQQPMQQQALPTPRLE-------------------------------PPPYH----IAR 654
                   .|.:.:|.|||.|.|                               .|..|    |:.
Yeast  1503 -------YQTLTKQHLPTKREEYERIRISGGYVNNGKLDGVVDVSRAVGFFDLLPHIHASPDISV 1560

  Fly   655 VYTKKTPEDL-----NLYESMRQRKQQQQLQEQTIYQDALNSNSNFKTTAIGAQDVEESV----- 709
            |...|..|.|     .|:|.|.........:|.:  .|.|.:.:..|..|: |....|::     
Yeast  1561 VTLTKADEMLIVATHKLWEYMDVDTVCDIARENS--TDPLRAAAELKDHAM-AYGCTENITILCL 1622

  Fly   710 ---DQLDYQNNISNNLEPNPEEEDQELDDTMSQHSLN-STATNNTSK--ASHKKSTWIFGVHKNP 768
               :.:..||..:.|............|.|:.:.... |..|.|.:.  ...|.||:::.:.  |
Yeast  1623 ALYENIQQQNRFTLNKNSLMTRRSTFEDTTLRRLQPEISPPTGNLAMVFTDIKSSTFLWELF--P 1685

  Fly   769 TVKQVTLKWENSI---------GFDIAELLNQVGIFVSSITPNTNAARLLNLNDKLLEI------ 818
            ...:..:|..|.|         |:::.  .......|:..||.:.....|::..|||:.      
Yeast  1686 NAMRTAIKTHNDIMRRQLRIYGGYEVK--TEGDAFMVAFPTPTSGLTWCLSVQLKLLDAQWPEEI 1748

  Fly   819 ----DGYDLTNAN 827
                ||..:|:.|
Yeast  1749 TSVQDGCQVTDRN 1761

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 54/203 (27%)
leucine-rich repeat 21..41 CDD:275380 8/44 (18%)
LRR_8 40..98 CDD:290566 18/58 (31%)
leucine-rich repeat 42..64 CDD:275380 4/22 (18%)
leucine-rich repeat 65..87 CDD:275380 8/22 (36%)
LRR_8 86..140 CDD:290566 21/54 (39%)
leucine-rich repeat 88..110 CDD:275380 10/22 (45%)
leucine-rich repeat 111..133 CDD:275380 9/22 (41%)
leucine-rich repeat 134..156 CDD:275380 4/22 (18%)
LRR_8 156..213 CDD:290566 17/57 (30%)
leucine-rich repeat 157..179 CDD:275380 6/22 (27%)
leucine-rich repeat 180..202 CDD:275380 5/22 (23%)
leucine-rich repeat 203..225 CDD:275380 9/46 (20%)
leucine-rich repeat 226..248 CDD:275380 9/22 (41%)
leucine-rich repeat 272..294 CDD:275380 9/99 (9%)
LRR_8 279..328 CDD:290566 21/127 (17%)
leucine-rich repeat 295..317 CDD:275380 9/23 (39%)
leucine-rich repeat 318..340 CDD:275380 8/22 (36%)
LRR_8 340..396 CDD:290566 20/83 (24%)
leucine-rich repeat 364..386 CDD:275380 7/40 (18%)
PDZ_signaling 770..846 CDD:238492 15/78 (19%)
CYR1NP_012529.3 Ad_cyc_g-alpha 368..418 CDD:285681
CYR1_RA 676..772 CDD:176370
leucine-rich repeat 796..817 CDD:275380 1/9 (11%)
leucine-rich repeat 818..839 CDD:275380 7/21 (33%)
leucine-rich repeat 840..864 CDD:275380 2/24 (8%)
LRR_8 864..921 CDD:290566 18/57 (32%)
leucine-rich repeat 865..887 CDD:275380 4/22 (18%)
LRR_RI 884..1145 CDD:238064 75/268 (28%)
leucine-rich repeat 888..910 CDD:275380 8/22 (36%)
leucine-rich repeat 911..933 CDD:275380 10/22 (45%)
leucine-rich repeat 934..956 CDD:275380 9/22 (41%)
LRR_8 937..989 CDD:290566 18/53 (34%)
leucine-rich repeat 957..978 CDD:275380 4/22 (18%)
leucine-rich repeat 979..1018 CDD:275380 12/45 (27%)
leucine-rich repeat 1019..1041 CDD:275380 7/22 (32%)
leucine-rich repeat 1042..1065 CDD:275380 2/23 (9%)
LRR_8 1066..1122 CDD:290566 22/56 (39%)
leucine-rich repeat 1066..1088 CDD:275380 9/22 (41%)
leucine-rich repeat 1089..1111 CDD:275380 8/22 (36%)
leucine-rich repeat 1167..1187 CDD:275380 0/20 (0%)
LRR_8 1190..1246 CDD:290566 18/56 (32%)
LRR_4 1190..1227 CDD:289563 12/37 (32%)
leucine-rich repeat 1191..1211 CDD:275380 4/20 (20%)
leucine-rich repeat 1236..1258 CDD:275380 8/22 (36%)
leucine-rich repeat 1259..1287 CDD:275380 10/31 (32%)
PP2C 1374..1617 CDD:278884 55/301 (18%)
CYCc 1613..1825 CDD:214485 28/154 (18%)
Nucleotidyl_cyc_III 1661..1837 CDD:299850 22/106 (21%)
AcyC 1763..2021 CDD:225025
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T634625
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.