DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and RPS4

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_199338.1 Gene:RPS4 AraportID:AT5G45250 Length:1217 Species:Arabidopsis thaliana

Alignment Length:511 Identity:107/512 (21%)
Similarity:195/512 (38%) Gaps:130/512 (25%)


  Fly    11 FKFKREEVIDKLDYSNTPLTDFPEVWQHERTLEE--LYLSTTRLQALPPQLFYCQGLRVLHVNSN 73
            :||.||  :| |..||...:....:|.|:..::.  :.:...:::|        ..:|.:.::.:
plant   512 YKFSRE--VD-LKASNQDGSRQRRLWLHQHIIKGGIINVLQNKMKA--------ANVRGIFLDLS 565

  Fly    74 NLESIPQA-------IGSLRQLQHL------DLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLP 125
            .:|.....       :|:||.|:..      :...|..:|:|:::|    |...::.|....:.|
plant   566 EVEDETSLDRDHFINMGNLRYLKFYNSHCPQECKTNNKINIPDKLK----LPLKEVRCLHWLKFP 626

  Fly   126 DAITSLISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEF 190
                              ||.||.:|..                        |||..|.:..:|.
plant   627 ------------------LETLPNDFNP------------------------INLVDLKLPYSEM 649

  Fly   191 TELPEVVGELKSLRELWIDFNQIRRVS--ANIGKLRDLQHFEANG-NLLDTLPSELSNWRNVEVL 252
            .:|.|...:...||  |:|.|...::.  :.:.|...||.....| ..|...|.::...:.:..|
plant   650 EQLWEGDKDTPCLR--WVDLNHSSKLCSLSGLSKAEKLQRLNLEGCTTLKAFPHDMKKMKMLAFL 712

  Fly   253 SI--CSNSLEAFP-FSVGMLKSLV-----TFK-------------CESNGLTELPDSISYLEQLE 296
            ::  |: |||:.| .::..||:|.     |||             .:...:::||.::..|::|.
plant   713 NLKGCT-SLESLPEMNLISLKTLTLSGCSTFKEFPLISDNIETLYLDGTAISQLPMNMEKLQRLV 776

  Fly   297 ELVLSHNKLI-RLPSTIGMLRSLR-FLFADDNQLRQLPDELCSCQQLSVLSVANNQLSALPQNIG 359
            .|.:...|:: .:|..:|.|::|: .:.:|...|:..|:  .....|::|.:....:..:||   
plant   777 VLNMKDCKMLEEIPGRVGELKALQELILSDCLNLKIFPE--IDISFLNILLLDGTAIEVMPQ--- 836

  Fly   360 NLSKMKVLNVVNN-YINALPVSMLNLVNLTSMWL-----SDNQSQPLVP--LQYLDASTKTQLTC 416
             |..::.|.:..| .|:.|||.:..|..|  .||     :...|.|..|  ||.|||.     .|
plant   837 -LPSVQYLCLSRNAKISCLPVGISQLSQL--KWLDLKYCTSLTSVPEFPPNLQCLDAH-----GC 893

  Fly   417 FMLPQVTFKMNSIQAQQQAQEQYEFVYANQQQPHASPSRRICFAEEATILSNAKAQ 472
            ..|..|:..:..|...:|....:.|......:..|.        ||.|..:..|.|
plant   894 SSLKTVSKPLARIMPTEQNHSTFIFTNCENLEQAAK--------EEITSYAQRKCQ 941

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 31/194 (16%)
leucine-rich repeat 21..41 CDD:275380 5/20 (25%)
LRR_8 40..98 CDD:290566 8/73 (11%)
leucine-rich repeat 42..64 CDD:275380 1/24 (4%)
leucine-rich repeat 65..87 CDD:275380 5/29 (17%)
LRR_8 86..140 CDD:290566 9/60 (15%)
leucine-rich repeat 88..110 CDD:275380 5/28 (18%)
leucine-rich repeat 111..133 CDD:275380 3/22 (14%)
leucine-rich repeat 134..156 CDD:275380 5/22 (23%)
LRR_8 156..213 CDD:290566 12/57 (21%)
leucine-rich repeat 157..179 CDD:275380 1/22 (5%)
leucine-rich repeat 180..202 CDD:275380 5/22 (23%)
leucine-rich repeat 203..225 CDD:275380 6/24 (25%)
leucine-rich repeat 226..248 CDD:275380 5/23 (22%)
leucine-rich repeat 272..294 CDD:275380 7/40 (18%)
LRR_8 279..328 CDD:290566 11/51 (22%)
leucine-rich repeat 295..317 CDD:275380 6/23 (26%)
leucine-rich repeat 318..340 CDD:275380 4/23 (17%)
LRR_8 340..396 CDD:290566 15/62 (24%)
leucine-rich repeat 364..386 CDD:275380 7/23 (30%)
PDZ_signaling 770..846 CDD:238492
RPS4NP_199338.1 PLN03210 16..1108 CDD:215633 107/512 (21%)
TIR 16..177 CDD:279864
AAA_16 208..343 CDD:289934
LRR_3 638..657 CDD:285026 6/19 (32%)
leucine-rich repeat 662..684 CDD:275381 6/24 (25%)
leucine-rich repeat 685..708 CDD:275380 5/23 (22%)
leucine-rich repeat 709..730 CDD:275380 6/22 (27%)
leucine-rich repeat 731..751 CDD:275380 6/20 (30%)
leucine-rich repeat 752..774 CDD:275380 3/22 (14%)
leucine-rich repeat 775..798 CDD:275380 6/23 (26%)
leucine-rich repeat 799..820 CDD:275380 4/23 (17%)
leucine-rich repeat 821..839 CDD:275380 5/22 (23%)
leucine-rich repeat 840..863 CDD:275380 7/23 (30%)
leucine-rich repeat 864..884 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D992188at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.