DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lap1 and PIRL4

DIOPT Version :10

Sequence 1:NP_611007.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_195272.1 Gene:PIRL4 / 829699 AraportID:AT4G35470 Length:549 Species:Arabidopsis thaliana


Alignment Length:280 Identity:98/280 - (35%)
Similarity:153/280 - (54%) Gaps:2/280 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQE 136
            :..||.:|.::|.|..|..|||:.|.||.:|..|.....||.|||..|.:.:||::|..|::|..
plant   232 TEQLEWLPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVY 296

  Fly   137 LLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELK 201
            |.|....|..||:.|.|||.|..|:|..|||..||:|:..|::|::||:..|:..|:|..:|...
plant   297 LNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCS 361

  Fly   202 SLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSV 266
            ||.||..|:|:::.:...|||:..|:......|.:..||:.:|:..:::.|.:..|.||:.|.|:
plant   362 SLIELRADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESL 426

  Fly   267 GMLKSLVTFKCESN--GLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLR 329
            ....:||.....:|  .:..||.||..||.||||.:|:|::..||.:..||..||...|.:|.|.
plant   427 CFATTLVKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLH 491

  Fly   330 QLPDELCSCQQLSVLSVANN 349
            ..|.::......:|:...|:
plant   492 IPPRDIAEKGPQAVVQYMND 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lap1NP_611007.1 LRR 12..407 CDD:443914 98/280 (35%)
leucine-rich repeat 21..41 CDD:275380
leucine-rich repeat 42..64 CDD:275380
leucine-rich repeat 65..87 CDD:275380 5/14 (36%)
leucine-rich repeat 88..110 CDD:275380 9/21 (43%)
leucine-rich repeat 111..133 CDD:275380 10/21 (48%)
leucine-rich repeat 134..156 CDD:275380 9/21 (43%)
leucine-rich repeat 157..179 CDD:275380 10/21 (48%)
leucine-rich repeat 180..202 CDD:275380 7/21 (33%)
leucine-rich repeat 203..225 CDD:275380 8/21 (38%)
leucine-rich repeat 226..248 CDD:275380 5/21 (24%)
leucine-rich repeat 272..294 CDD:275380 8/23 (35%)
leucine-rich repeat 295..317 CDD:275380 10/21 (48%)
leucine-rich repeat 318..340 CDD:275380 6/21 (29%)
leucine-rich repeat 364..386 CDD:275380
PDZ_canonical 778..846 CDD:467153
PIRL4NP_195272.1 LRR 200..>490 CDD:443914 94/257 (37%)
leucine-rich repeat 271..293 CDD:275380 10/21 (48%)
leucine-rich repeat 294..316 CDD:275380 9/21 (43%)
leucine-rich repeat 317..339 CDD:275380 10/21 (48%)
leucine-rich repeat 340..362 CDD:275380 7/21 (33%)
leucine-rich repeat 363..385 CDD:275380 8/21 (38%)
leucine-rich repeat 386..408 CDD:275380 5/21 (24%)
leucine-rich repeat 409..431 CDD:275380 6/21 (29%)
leucine-rich repeat 432..456 CDD:275380 8/23 (35%)
leucine-rich repeat 457..479 CDD:275380 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.