DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lap1 and PIRL4

DIOPT Version :9

Sequence 1:NP_001188938.1 Gene:Lap1 / 36670 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_195272.1 Gene:PIRL4 / 829699 AraportID:AT4G35470 Length:549 Species:Arabidopsis thaliana


Alignment Length:280 Identity:98/280 - (35%)
Similarity:153/280 - (54%) Gaps:2/280 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISLQE 136
            :..||.:|.::|.|..|..|||:.|.||.:|..|.....||.|||..|.:.:||::|..|::|..
plant   232 TEQLEWLPDSLGKLSSLTSLDLSENHIVVLPNTIGGLSSLTKLDLHSNRIGQLPESIGELLNLVY 296

  Fly   137 LLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGELK 201
            |.|....|..||:.|.|||.|..|:|..|||..||:|:..|::|::||:..|:..|:|..:|...
plant   297 LNLGSNQLSSLPSAFSRLVRLEELDLSCNNLPILPESIGSLVSLKKLDVETNDIEEIPYSIGGCS 361

  Fly   202 SLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPFSV 266
            ||.||..|:|:::.:...|||:..|:......|.:..||:.:|:..:::.|.:..|.||:.|.|:
plant   362 SLIELRADYNKLKALPEAIGKITTLEILSVRYNNIRQLPTTMSSLASLKELDVSFNELESVPESL 426

  Fly   267 GMLKSLVTFKCESN--GLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLR 329
            ....:||.....:|  .:..||.||..||.||||.:|:|::..||.:..||..||...|.:|.|.
plant   427 CFATTLVKLNIGNNFADMVSLPRSIGNLEMLEELDISNNQIRVLPDSFKMLTKLRVFRAQENPLH 491

  Fly   330 QLPDELCSCQQLSVLSVANN 349
            ..|.::......:|:...|:
plant   492 IPPRDIAEKGPQAVVQYMND 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 51/127 (40%)
leucine-rich repeat 21..41 CDD:275380
LRR_8 40..98 CDD:290566 10/25 (40%)
leucine-rich repeat 42..64 CDD:275380
leucine-rich repeat 65..87 CDD:275380 5/14 (36%)
LRR_8 86..140 CDD:290566 21/53 (40%)
leucine-rich repeat 88..110 CDD:275380 9/21 (43%)
leucine-rich repeat 111..133 CDD:275380 10/21 (48%)
leucine-rich repeat 134..156 CDD:275380 9/21 (43%)
LRR_8 156..213 CDD:290566 23/56 (41%)
leucine-rich repeat 157..179 CDD:275380 10/21 (48%)
leucine-rich repeat 180..202 CDD:275380 7/21 (33%)
leucine-rich repeat 203..225 CDD:275380 8/21 (38%)
leucine-rich repeat 226..248 CDD:275380 5/21 (24%)
leucine-rich repeat 272..294 CDD:275380 8/23 (35%)
LRR_8 279..328 CDD:290566 21/50 (42%)
leucine-rich repeat 295..317 CDD:275380 10/21 (48%)
leucine-rich repeat 318..340 CDD:275380 6/21 (29%)
LRR_8 340..396 CDD:290566 2/10 (20%)
leucine-rich repeat 364..386 CDD:275380
PDZ_signaling 770..846 CDD:238492
PIRL4NP_195272.1 LRR 194..>471 CDD:227223 86/238 (36%)
leucine-rich repeat 271..293 CDD:275380 10/21 (48%)
leucine-rich repeat 294..316 CDD:275380 9/21 (43%)
leucine-rich repeat 317..339 CDD:275380 10/21 (48%)
leucine-rich repeat 340..362 CDD:275380 7/21 (33%)
leucine-rich repeat 363..385 CDD:275380 8/21 (38%)
leucine-rich repeat 386..408 CDD:275380 5/21 (24%)
leucine-rich repeat 409..431 CDD:275380 6/21 (29%)
leucine-rich repeat 432..456 CDD:275380 8/23 (35%)
leucine-rich repeat 457..479 CDD:275380 10/21 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3538
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.