DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and LRRC7

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:XP_016857374.1 Gene:LRRC7 HGNCID:18531 Length:1594 Species:Homo sapiens

Alignment Length:996 Identity:298/997 (30%)
Similarity:457/997 (46%) Gaps:251/997 (25%)


  Fly     3 LLSKCFPCFKFK-REEVIDKLDYSNTPLTDFP-EVWQHERTLEELYLSTTRLQALPPQLFYCQGL 65
            ::.:..||..|: .||:|..||||:..|...| ||:..|||||||||...:::.||.|||.||.|
Human    64 IIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEELPKQLFNCQAL 128

  Fly    66 RVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITS 130
            |.|.:..|:|.::|..|.||..|:.||:::|.:...||.||.||.||.::.|.|.:.:|||..|.
Human   129 RKLSIPDNDLSNLPTTIASLVNLKELDISKNGVQEFPENIKCCKCLTIIEASVNPISKLPDGFTQ 193

  Fly   131 LISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPE 195
            |::|.:|.||:.:||||||||||||.|||||||.|:|.||||||.:|..|:|||:|.|||.||||
Human   194 LLNLTQLYLNDAFLEFLPANFGRLVKLRILELRENHLKTLPKSMHKLAQLERLDLGNNEFGELPE 258

  Fly   196 VVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLE 260
            |:.::::|||||:|.|.::.:..:||||:.|.:.:.:.|.::|:..::|....:|.|.:.||.|:
Human   259 VLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQ 323

  Fly   261 AFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADD 325
            ..|.|:|:||.|.|.|.:.|.||.||::|..|..|||...|.|:|..||||||.|.|||.|..|:
Human   324 QLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEEFDCSCNELESLPSTIGYLHSLRTLAVDE 388

  Fly   326 NQLRQLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSM 390
            |.|.:||.|:.||:.::|:|:.:|:|..||:.||.:.|::|||:.:|.:..||.|...|..|.::
Human   389 NFLPELPREIGSCKNVTVMSLRSNKLEFLPEEIGQMQKLRVLNLSDNRLKNLPFSFTKLKELAAL 453

  Fly   391 WLSDNQSQPLVPLQYLDASTKTQ---LTCFMLPQ-----VTFKMNS---------IQAQQQAQEQ 438
            |||||||:.|:||| .:|..:|:   ||.:|.||     ..|:.:|         .|.||:....
Human   454 WLSDNQSKALIPLQ-TEAHPETKQRVLTNYMFPQQPRGDEDFQSDSDSFNPTLWEEQRQQRMTVA 517

  Fly   439 YEFVYANQQQPHA---------------------SPSRRI--CFAEEATILSNAKAQPAP-NYPS 479
            :||....:...:|                     .|:|..  |....|......:..|.| |.|.
Human   518 FEFEDKKEDDENAGKVKDLSCQAPWERGQRGITLQPARLSGDCCTPWARCDQQIQDMPVPQNDPQ 582

  Fly   480 F-------------------VAAPPTPTPDQMAG---SVRLMRSPTPYPKELRQMSKYVR----- 517
            .                   |||..|..| .::|   .:.|.|.|||||::|:.|.|.|:     
Human   583 LAWGCISGLQQERSMCTPLPVAAQSTTLP-SLSGRQVEINLKRYPTPYPEDLKNMVKSVQNLVGK 646

  Fly   518 -----QAQAATSSANASE-----------------------VREARVVTNGQI------------ 542
                 :.:.:..:||..:                       |..|..:..|::            
Human   647 PSHGVRVENSNPTANTEQTVKEKYEHKWPVAPKEITVEDSFVHPANEMRIGELHPSLAETPLYPP 711

  Fly   543 ---------------------HCDSNNAN--------------------------QDVVDQATTS 560
                                 ||.:|:.:                          |.....|..:
Human   712 KLVLLGKDKKESTDESEVDKTHCLNNSVSSGTYSDYSPSQASSGSSNTRVKVGSLQTTAKDAVHN 776

  Fly   561 AIYG--IAPETTHIYGVYQQP--------QQMAHP---VPTQEYYGLPLV-----NYE--AHYQQ 605
            :::|  |||.       :.||        |:.|.|   :| |....||:.     |:.  :||..
Human   777 SLWGNRIAPS-------FPQPLDSKPLLSQREAVPPGNIP-QRPDRLPMSDTFTDNWTDGSHYDN 833

  Fly   606 L-YVEANT--------PLPTTHLNGDQDYELQPLQQQ------PM---QQQALPTPRLEPPPYHI 652
            . :|...|        ||.::.......:..:||.:|      |:   |.....||..|.||.:.
Human   834 TGFVAEETTAENANSNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSNP 898

  Fly   653 ARVYTKKTP---EDLNLYESMRQR--------KQQQQLQEQT------------IYQDALNSNSN 694
            .:.:| :||   ||...:.|..:.        ::::.::|.|            .|.|: |.|.:
Human   899 WQNWT-RTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEIPSPFSPGVPWEYHDS-NPNRS 961

  Fly   695 FKT----------TAIGAQDVEESVDQLDYQNNISNNLEPNPEEEDQELD--DTMSQHSLNSTAT 747
            ...          ::.|...:.:|.::|   :.:..:::.|..::.|.:|  |..:....|....
Human   962 LSNVFSQIHCRPESSKGVISISKSTERL---SPLMKDIKSNKFKKSQSIDEIDIGTYKVYNIPLE 1023

  Fly   748 NNTSKASHKKSTWIFGVHKNP 768
            |..|.:.|      .|.|:.|
Human  1024 NYASGSDH------LGSHERP 1038

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 97/180 (54%)
leucine-rich repeat 21..41 CDD:275380 10/21 (48%)
LRR_8 40..98 CDD:290566 28/58 (48%)
leucine-rich repeat 42..64 CDD:275380 13/22 (59%)
leucine-rich repeat 65..87 CDD:275380 9/22 (41%)
LRR_8 86..140 CDD:290566 22/54 (41%)
leucine-rich repeat 88..110 CDD:275380 10/22 (45%)
leucine-rich repeat 111..133 CDD:275380 9/22 (41%)
leucine-rich repeat 134..156 CDD:275380 16/22 (73%)
LRR_8 156..213 CDD:290566 36/57 (63%)
leucine-rich repeat 157..179 CDD:275380 16/22 (73%)
leucine-rich repeat 180..202 CDD:275380 13/22 (59%)
leucine-rich repeat 203..225 CDD:275380 11/22 (50%)
leucine-rich repeat 226..248 CDD:275380 4/22 (18%)
leucine-rich repeat 272..294 CDD:275380 10/22 (45%)
LRR_8 279..328 CDD:290566 26/49 (53%)
leucine-rich repeat 295..317 CDD:275380 13/22 (59%)
leucine-rich repeat 318..340 CDD:275380 11/22 (50%)
LRR_8 340..396 CDD:290566 23/56 (41%)
leucine-rich repeat 364..386 CDD:275380 8/22 (36%)
PDZ_signaling 770..846 CDD:238492
LRRC7XP_016857374.1 LRR_RI <81..269 CDD:238064 101/188 (54%)
leucine-rich repeat 83..104 CDD:275380 10/21 (48%)
LRR_8 103..159 CDD:290566 27/56 (48%)
leucine-rich repeat 105..127 CDD:275380 13/22 (59%)
leucine-rich repeat 128..150 CDD:275380 9/22 (41%)
leucine-rich repeat 151..196 CDD:275380 19/45 (42%)
LRR_8 196..251 CDD:290566 37/55 (67%)
leucine-rich repeat 197..219 CDD:275380 16/22 (73%)
LRR_RI 218..458 CDD:238064 112/240 (47%)
leucine-rich repeat 220..242 CDD:275380 16/22 (73%)
leucine-rich repeat 243..265 CDD:275380 13/22 (59%)
LRR_8 265..322 CDD:290566 19/57 (33%)
leucine-rich repeat 266..288 CDD:275380 11/22 (50%)
leucine-rich repeat 289..311 CDD:275380 4/22 (18%)
leucine-rich repeat 335..355 CDD:275380 9/20 (45%)
leucine-rich repeat 358..380 CDD:275380 13/22 (59%)
leucine-rich repeat 381..403 CDD:275380 11/22 (50%)
LRR_8 402..459 CDD:290566 23/57 (40%)
leucine-rich repeat 404..426 CDD:275380 8/22 (36%)
leucine-rich repeat 427..449 CDD:275380 8/22 (36%)
PDZ_signaling 1504..1589 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BA7S
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 405 1.000 Inparanoid score I1879
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D148064at33208
OrthoFinder 1 1.000 FOG0005840
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133203
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.923 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.