DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and scrib

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_001163746.1 Gene:scrib FlyBaseID:FBgn0263289 Length:2585 Species:Drosophila melanogaster

Alignment Length:912 Identity:255/913 (28%)
Similarity:414/913 (45%) Gaps:165/913 (18%)


  Fly     6 KCFPCFK--FKREEVIDKLDYSNTPLTDFP-EVWQHERTLEELYLSTTRLQALPPQLFYCQGLRV 67
            ||.|.||  .::.|.:||...|   |...| |:.::.||||||:|....::.||...|....||.
  Fly     3 KCIPIFKGCNRQVEFVDKRHCS---LPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLHRLRK 64

  Fly    68 LHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLI 132
            |.::.|.:..:|..|.:...|..||::||.|.::|::||..:.|...|.|.|.:.:||...:.|.
  Fly    65 LGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPKLPSGFSQLK 129

  Fly   133 SLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVV 197
            :|..|.||:..|..|||:||.|..|..||||.|.|..||:::.:|..|:|||:|.||..:||..:
  Fly   130 NLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRLDLGDNEIEDLPPYL 194

  Fly   198 GELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAF 262
            |.|..|.|||:|.||::|:...:|.|..|.:.:.:.|.|:.||:|:|...::..|.:..|.|||.
  Fly   195 GYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEISGLVSLTDLDLAQNLLEAL 259

  Fly   263 PFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQ 327
            |..:..|..|...|.:.|.|..|.|::...|.::||:|:.|.|..||::||.:..|..|..|.|.
  Fly   260 PDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTENFLSELPASIGQMTKLNNLNVDRNA 324

  Fly   328 LRQLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWL 392
            |..||.|:..|..|.|||:.:|:|..||..:||.:.:.||:|..|.:..||.|::|| .|.::||
  Fly   325 LEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTVLHVLDVSGNQLLYLPYSLVNL-QLKAVWL 388

  Fly   393 SDNQSQPLVPLQ-YLDASTKTQ-LTCFMLPQVTFK----MNSIQAQQQAQEQYEFVYANQQQPHA 451
            |:||||||:..| ..||.|..| |:|::|||..::    ...:::..:..|:.|           
  Fly   389 SENQSQPLLTFQPDTDAETGEQVLSCYLLPQQEYQPITPARDLESDSEPFEERE----------- 442

  Fly   452 SPSRRIC-FAEEATILSNAKAQPAPNYPSFVAAPPTPTPDQMAGSVRLMRSPTPYPKELRQMSKY 515
             |||.:. |:||||   ..|..|                        .:|..||:||:|:     
  Fly   443 -PSRTVVKFSEEAT---QEKETP------------------------FVRQNTPHPKDLK----- 474

  Fly   516 VRQAQAATSSANASEVREARVVTNGQIHCDSNNANQDVVDQATTSAIYGIAPETTHIYGVYQQPQ 580
                    :.|...:|..:|         :..:||...:.:...:.:.....||..|...:||  
  Fly   475 --------AKAQKLKVERSR---------NEEHANLVTLPEENGTKLAETPTETRTIANNHQQ-- 520

  Fly   581 QMAHPVPTQEYYGLPLVNYEAHYQQLYVEANTPLPTT---------------------------- 617
               .|.|.|:    |:|...:. |.:.|...||..||                            
  Fly   521 ---QPHPVQQ----PIVGVNSK-QPVVVGVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAAVV 577

  Fly   618 -------------HLNGDQDYELQPLQQQPMQQQALPTPRLEPPPYHIARVYTKKTPEDLNLYES 669
                         ..:.:|:.|.:..::...|.:.......:.||    :::.:.||..|     
  Fly   578 AELAATVGGSDEVQDDDEQEDEFESDRRVGFQVEGEDDDFYKRPP----KLHRRDTPHHL----- 633

  Fly   670 MRQRKQQQQLQEQTIYQDALNSNSNFKTTAIGAQDVEESVDQLDYQNNISNNLEPNPE-EEDQEL 733
              :.|:.|.|.::        ..|.....|:.:|:..::..|......:::.:|...: |.:||.
  Fly   634 --KNKRVQHLTDK--------QASEILANALASQERNDTTPQHSLSGKVTSPIEEEEQLEVEQEQ 688

  Fly   734 DDTMSQH----SLNSTATNNTSKASHKKSTWIFGVHKNPTVKQVTLKWENS---IGFDIAELLNQ 791
            .....||    ||:..:...|::||..... :.|| ....::|..:..|.:   :|..||.....
  Fly   689 QQQQQQHPFDSSLSPISAGKTAEASTDPDN-LDGV-TELRLEQYEIHIERTAAGLGLSIAGGKGS 751

  Fly   792 V-------GIFVSSITPNTNAARL--LNLNDKLLEIDGYDLTNANLSDAKRVLLNCGTVMNIMLS 847
            .       |||:|.:| ....|.|  |.:.||:::::|..:.:|:...|.:||..||.|:.:::.
  Fly   752 TPFKGDDDGIFISRVT-EAGPADLAGLKVGDKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQ 815

  Fly   848 RK 849
            |:
  Fly   816 RE 817

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 68/180 (38%)
leucine-rich repeat 21..41 CDD:275380 6/21 (29%)
LRR_8 40..98 CDD:290566 21/58 (36%)
leucine-rich repeat 42..64 CDD:275380 8/22 (36%)
leucine-rich repeat 65..87 CDD:275380 6/22 (27%)
LRR_8 86..140 CDD:290566 19/54 (35%)
leucine-rich repeat 88..110 CDD:275380 9/22 (41%)
leucine-rich repeat 111..133 CDD:275380 7/22 (32%)
leucine-rich repeat 134..156 CDD:275380 11/22 (50%)
LRR_8 156..213 CDD:290566 28/57 (49%)
leucine-rich repeat 157..179 CDD:275380 10/22 (45%)
leucine-rich repeat 180..202 CDD:275380 11/22 (50%)
leucine-rich repeat 203..225 CDD:275380 10/22 (45%)
leucine-rich repeat 226..248 CDD:275380 7/22 (32%)
leucine-rich repeat 272..294 CDD:275380 7/22 (32%)
LRR_8 279..328 CDD:290566 18/49 (37%)
leucine-rich repeat 295..317 CDD:275380 9/22 (41%)
leucine-rich repeat 318..340 CDD:275380 9/22 (41%)
LRR_8 340..396 CDD:290566 24/56 (43%)
leucine-rich repeat 364..386 CDD:275380 9/22 (41%)
PDZ_signaling 770..846 CDD:238492 23/88 (26%)
scribNP_001163746.1 LRR_RI 13..283 CDD:238064 100/273 (37%)
leucine-rich repeat 18..38 CDD:275380 7/23 (30%)
LRR_8 37..95 CDD:290566 21/58 (36%)
leucine-rich repeat 39..61 CDD:275380 8/22 (36%)
leucine-rich repeat 62..84 CDD:275380 6/22 (27%)
LRR_8 84..138 CDD:290566 20/54 (37%)
leucine-rich repeat 85..107 CDD:275380 9/22 (41%)
leucine-rich repeat 108..130 CDD:275380 7/22 (32%)
LRR_8 129..187 CDD:290566 28/58 (48%)
leucine-rich repeat 131..153 CDD:275380 11/22 (50%)
leucine-rich repeat 154..176 CDD:275380 10/22 (45%)
leucine-rich repeat 177..199 CDD:275380 11/22 (50%)
LRR_8 198..256 CDD:290566 19/58 (33%)
leucine-rich repeat 200..222 CDD:275380 10/22 (45%)
leucine-rich repeat 223..245 CDD:275380 7/22 (32%)
LRR_8 267..325 CDD:290566 20/58 (34%)
leucine-rich repeat 269..289 CDD:275380 6/20 (30%)
leucine-rich repeat 292..314 CDD:275380 9/22 (41%)
leucine-rich repeat 315..337 CDD:275380 9/22 (41%)
LRR_4 337..375 CDD:289563 15/38 (39%)
leucine-rich repeat 361..382 CDD:275380 9/22 (41%)
PDZ 728..816 CDD:214570 23/89 (26%)
PDZ_signaling 931..1016 CDD:238492
PDZ 1239..1329 CDD:214570
PDZ_signaling 1336..1425 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BA7S
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D148064at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.