DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and scrib

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:XP_021333089.1 Gene:scrib ZFINID:ZDB-GENE-030616-572 Length:2047 Species:Danio rerio

Alignment Length:931 Identity:274/932 (29%)
Similarity:399/932 (43%) Gaps:202/932 (22%)


  Fly     6 KCFPCFKFKRE-EVIDKLDYSNTPLTDFPEVWQHERTLEELYLSTTRLQALPPQLFYCQGLRVLH 69
            ||.|.::..|. |.:||...|.|.:.|  |::::.|:||||.|...:|:.||...|....||.|.
Zfish     3 KCIPLWRCNRHVESVDKRHCSLTAVPD--EIYRYNRSLEELLLDANQLRELPKPFFRLHNLRKLG 65

  Fly    70 VNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISL 134
            ::.|.::.:|..:.:..||..||::||.|..:||.||.|:.|...|.|.|.|.||||..|.|..|
Zfish    66 LSDNEIQKLPPDVANFTQLVELDISRNDISEIPENIKFCQSLEIADFSGNPLTRLPDGFTQLRGL 130

  Fly   135 QELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGE 199
            ..|.||:..|:.||.:.|.|.||..||||.|.|.:||.|:..|:.|::||:|.|....||:.:|.
Zfish   131 AHLSLNDVSLQSLPNDIGNLSNLVTLELRENLLKSLPSSLSFLVKLEQLDLGSNVLEVLPDTLGA 195

  Fly   200 LKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPF 264
            |.:|||||:|.||:..:...:|.||.|...:.:.|.|..||:|:|....:..|.:..|.||..|.
Zfish   196 LPNLRELWLDRNQLSSLPPELGNLRQLVCLDVSENRLSELPTEISGLIALTDLLLSENLLEILPD 260

  Fly   265 SVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLR 329
            |:|.||.|...|...|.|..|.|||...|.|.||:|:.|.|..||.::|.|:.|..|..|.|:|.
Zfish   261 SIGSLKKLSILKVNQNRLVHLTDSIGECENLTELMLTENLLQSLPRSLGKLKKLTNLNVDRNRLS 325

  Fly   330 QLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSD 394
            .:|.||..|..|:|||:.:|:|..||..:.|.:::.||:|..|.:..||.::.|| ||.:|||::
Zfish   326 SVPAELGGCVSLNVLSLRDNRLGKLPPELANATELHVLDVAGNRLQNLPFALANL-NLKAMWLAE 389

  Fly   395 NQSQPLVPLQYLD--ASTKTQLTCFMLPQVTFKMNSIQAQQQAQEQYEFVYANQQQPHASPSRRI 457
            |||||::..|..|  .:.:..|||::||                          |||.:|     
Zfish   390 NQSQPMLKFQTEDDEQTGEKVLTCYLLP--------------------------QQPSSS----- 423

  Fly   458 CFAEEATILSNAKAQPAPNYPSFVAAPPTPT-------------------PDQMAGSVR--LMRS 501
                    |.|...:      |...|.||.|                   .|:.|...|  |.|.
Zfish   424 --------LENLLER------SVDEAWPTDTNLNRVSVIQFRDDSKHEEEDDETAADKRQGLQRR 474

  Fly   502 PTPYPKELRQMSKYVRQAQAATSSANASEVREARVVTNGQIHCDSNNANQDVVDQATTSAIYGIA 566
            .||:|.||:.|...:...:....:|...|..|:......::...||.::......:||||     
Zfish   475 ATPHPSELKVMKNVIEARRNEAYTARPDEDLESPDAEEKRLSGLSNQSHDSQASSSTTSA----- 534

  Fly   567 PETTHIYGVYQQPQQMAHPVPTQEYYGLPLVNYEAHYQQLY-------VEANTPLPTTHL----- 619
              |:|                 ::..|:.....|.:..|:.       :|.....||.|.     
Zfish   535 --TSH-----------------EDKQGINSTGVELNDGQVQEEEDLDEMEVEYTEPTVHFAEEPI 580

  Fly   620 ----NGDQDY-----------ELQPLQQQPMQQQAL---PTPRLE--------PPPYHIARVY-- 656
                :.|.||           |:......|.::|.|   .||..:        |.|..:|.:.  
Zfish   581 IRGGDEDDDYDNDDDDAERSDEVSQTPSFPAEKQRLIRKDTPHYKKHFKITKLPKPETVAALLQG 645

  Fly   657 --------TKKTPEDLNLYESMRQRKQQQQLQEQTIYQDALNSNSNFKTTAIGAQDVEESVDQLD 713
                    |..||      |:.|..:..::.:|....:|.|::....:..|...:|:..|     
Zfish   646 FSHDGLSPTAHTP------ENERDGEDDEEEEEDEDEEDDLHTPFQHRLDAAELEDIRMS----- 699

  Fly   714 YQNNIS------------NNLEPNPEE-EDQELDDTMSQHSLNSTATNNTSKASHKKSTWIFGVH 765
             |.|.|            |||...|.. |::||  |:|  .|..|.....|.|..|.||...|  
Zfish   700 -QMNSSLQPVKGVSFDQVNNLLIEPARIEEEEL--TLS--ILRQTGGLGISIAGGKGSTPYKG-- 757

  Fly   766 KNPTVKQVTLKWENSIGFDIAELLNQVGIFVSSITPNTNAARL-LNLNDKLLEIDGYDLTNANLS 829
                                    :..|||:|.::....|||. :.:.|||||::|.||..|...
Zfish   758 ------------------------DDEGIFISRVSEEGPAARAGVKVGDKLLEVNGVDLHGAEHH 798

  Fly   830 DAKRVLLNCG--TVMNIMLSR 848
            .|...|.|.|  .||.::..|
Zfish   799 TAVEALRNSGAAVVMTVLRER 819

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 72/179 (40%)
leucine-rich repeat 21..41 CDD:275380 6/20 (30%)
LRR_8 40..98 CDD:290566 21/58 (36%)
leucine-rich repeat 42..64 CDD:275380 9/22 (41%)
leucine-rich repeat 65..87 CDD:275380 5/22 (23%)
LRR_8 86..140 CDD:290566 26/54 (48%)
leucine-rich repeat 88..110 CDD:275380 11/22 (50%)
leucine-rich repeat 111..133 CDD:275380 11/22 (50%)
leucine-rich repeat 134..156 CDD:275380 9/22 (41%)
LRR_8 156..213 CDD:290566 29/57 (51%)
leucine-rich repeat 157..179 CDD:275380 11/22 (50%)
leucine-rich repeat 180..202 CDD:275380 9/22 (41%)
leucine-rich repeat 203..225 CDD:275380 11/22 (50%)
leucine-rich repeat 226..248 CDD:275380 7/22 (32%)
leucine-rich repeat 272..294 CDD:275380 9/22 (41%)
LRR_8 279..328 CDD:290566 21/49 (43%)
leucine-rich repeat 295..317 CDD:275380 10/22 (45%)
leucine-rich repeat 318..340 CDD:275380 9/22 (41%)
LRR_8 340..396 CDD:290566 23/56 (41%)
leucine-rich repeat 364..386 CDD:275380 8/22 (36%)
PDZ_signaling 770..846 CDD:238492 22/79 (28%)
scribXP_021333089.1 leucine-rich repeat 14..37 CDD:275380 8/25 (32%)
LRR <37..306 CDD:227223 111/269 (41%)
leucine-rich repeat 38..60 CDD:275380 9/22 (41%)
leucine-rich repeat 61..83 CDD:275380 5/22 (23%)
leucine-rich repeat 84..106 CDD:275380 11/22 (50%)
leucine-rich repeat 107..129 CDD:275380 11/22 (50%)
leucine-rich repeat 130..152 CDD:275380 9/22 (41%)
leucine-rich repeat 153..175 CDD:275380 11/22 (50%)
leucine-rich repeat 176..198 CDD:275380 9/22 (41%)
LRR <192..458 CDD:227223 102/312 (33%)
leucine-rich repeat 199..221 CDD:275380 11/22 (50%)
leucine-rich repeat 222..248 CDD:275380 7/26 (27%)
leucine-rich repeat 268..290 CDD:275380 9/22 (41%)
leucine-rich repeat 291..313 CDD:275380 10/22 (45%)
leucine-rich repeat 314..336 CDD:275380 9/22 (41%)
leucine-rich repeat 360..380 CDD:275380 7/20 (35%)
PDZ_signaling 739..816 CDD:238492 29/103 (28%)
PDZ_signaling 875..952 CDD:238492
PDZ_signaling 1004..1092 CDD:238492
PDZ_signaling 1102..1191 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BA7S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D148064at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.