DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and Erbin

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:XP_017446674.1 Gene:Erbin RGDID:1562952 Length:1451 Species:Rattus norvegicus

Alignment Length:843 Identity:269/844 (32%)
Similarity:413/844 (49%) Gaps:139/844 (16%)


  Fly     3 LLSKCFPCFKFK-REEVIDKLDYSNTPLTDFP-EVWQHERTLEELYLSTTRLQALPPQLFYCQGL 65
            |..:..||...: .||.:..||||:..|...| |::..|:|||||||...:::.||.|||.||.|
  Rat     7 LFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQSL 71

  Fly    66 RVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITS 130
            ..|.:..|:|.::|.:|.:|..|:.||:::|.|...||.||:||.||.::.|.|.:.:|||..:.
  Rat    72 HKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTVVEASVNPISKLPDGFSQ 136

  Fly   131 LISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPE 195
            |::|.:|.||:.:|||||||||||..|:|||||.|.|..||||..||..|:.||:|.|||::.||
  Rat   137 LLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKSNHRLTQLEELDLGSNEFSQQPE 201

  Fly   196 VVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLE 260
            |:.:|..|||.|:|.|::..:...||.||.|.:.:.:.|.::.:...:|...|::...:.||||:
  Rat   202 VLEQLSGLREFWMDGNRLTFIPGFIGSLRQLTYLDVSKNNIEMVEEGISTCENLQDFLLSSNSLQ 266

  Fly   261 AFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADD 325
            ..|.::|.||::.|.|.:.|.|..|||||..|..:|||..|.|::..|||:||.|.::|...||.
  Rat   267 QLPETIGSLKNVTTLKIDENQLMYLPDSIGGLRSIEELDCSFNEIEALPSSIGQLTNIRTFAADH 331

  Fly   326 NQLRQLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSM 390
            |.|:|||.|:.:.:.::||.:.:|:|..||:.:|::.|:||:|:.:|.:..||.|...|..||:|
  Rat   332 NYLQQLPPEIGNWKNVTVLFLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAM 396

  Fly   391 WLSDNQSQPLVPLQ-YLDAST-KTQLTCFMLPQVTFKMNSIQAQQQAQEQYEFVYANQQ-QPHAS 452
            |||||||:||:||| ..|:.| |..||.:|.|           ||...|...|:..|:. .|...
  Rat   397 WLSDNQSKPLIPLQKETDSETQKMVLTNYMFP-----------QQPRTEDVMFISDNESFNPALW 450

  Fly   453 PSRRICFAEEATILSNAKAQPAPNYPSFVAAPPTPTPDQMAGSVRLMRSPTPYPKELRQMSKYV- 516
            ..:|...|:.|......|.:.        .|||.        ...|.|.|||||.||:.|.|.| 
  Rat   451 EEQRKQRAQVAFECDEDKDER--------EAPPR--------EGNLKRYPTPYPDELKNMVKTVQ 499

  Fly   517 ----RQAQAATSSANASEVREARVVTNGQIHCDSNNANQDVVDQATTSAIYGIAP-ETTHIYGVY 576
                |.....|:..:..::::         |.|....|:|          .|:.| |:.......
  Rat   500 TIVHRLKDEETNEESGRDLKQ---------HEDQQVVNKD----------KGVKPSESITTKSKL 545

  Fly   577 QQPQQMAHPVP-TQEYYGLPLVNYEAHYQQLYVEANTPLPTT--------HL-NGDQDYELQPLQ 631
            .:.::..:.|| |.|    |.....|        .|:|:.|.        || |.|..:|     
  Rat   546 DEREKYMNSVPKTSE----PEAETNA--------GNSPVTTNRKSSGNMKHLVNHDDVFE----- 593

  Fly   632 QQPMQQQALPTPRLEPPPYHIARVYTKKTPEDLNLYESMRQRKQQQQLQEQTIYQDALNSNSNFK 696
                                        ..|:|:..|.|:..:.:..|.|.:|.|..:.:.||.|
  Rat   594 ----------------------------ESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNK 630

  Fly   697 TTAIGAQDVEESVDQLDYQNNISNNLEPNPEEEDQELDDTMSQHSLNSTATNNTSKASHKKSTWI 761
            ..  .|:|.:...|::.:.:|.:|:...:|    ..:.|::   |||:.::.:|:..|..|.   
  Rat   631 KD--DAKDTDSLSDEVTHNSNQNNSNCSSP----SRMSDSV---SLNTDSSQDTALCSPAKQ--- 683

  Fly   762 FGVHKNPTVKQVTLKWENSIGFDIAELLNQVGIFVSSITPNTNAARLLNLNDKL-LEIDGYDL 823
            ..:..|..::|....: ||:      |.|.|.:       |.:......:|||. .::..|||
  Rat   684 IPIDSNSKIRQEDENF-NSL------LQNGVNL-------NNSPEEKFKINDKKDFKLPEYDL 732

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 87/180 (48%)
leucine-rich repeat 21..41 CDD:275380 8/21 (38%)
LRR_8 40..98 CDD:290566 25/58 (43%)
leucine-rich repeat 42..64 CDD:275380 13/22 (59%)
leucine-rich repeat 65..87 CDD:275380 7/22 (32%)
LRR_8 86..140 CDD:290566 22/54 (41%)
leucine-rich repeat 88..110 CDD:275380 11/22 (50%)
leucine-rich repeat 111..133 CDD:275380 8/22 (36%)
leucine-rich repeat 134..156 CDD:275380 15/22 (68%)
LRR_8 156..213 CDD:290566 31/57 (54%)
leucine-rich repeat 157..179 CDD:275380 14/22 (64%)
leucine-rich repeat 180..202 CDD:275380 11/22 (50%)
leucine-rich repeat 203..225 CDD:275380 10/22 (45%)
leucine-rich repeat 226..248 CDD:275380 3/22 (14%)
leucine-rich repeat 272..294 CDD:275380 10/22 (45%)
LRR_8 279..328 CDD:290566 23/49 (47%)
leucine-rich repeat 295..317 CDD:275380 11/22 (50%)
leucine-rich repeat 318..340 CDD:275380 9/22 (41%)
LRR_8 340..396 CDD:290566 24/56 (43%)
leucine-rich repeat 364..386 CDD:275380 8/22 (36%)
PDZ_signaling 770..846 CDD:238492 13/56 (23%)
ErbinXP_017446674.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BA7S
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 405 1.000 Inparanoid score I1814
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D148064at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.