DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and Lrrc7

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_001357710.1 Gene:Lrrc7 MGIID:2676665 Length:1575 Species:Mus musculus

Alignment Length:993 Identity:291/994 (29%)
Similarity:450/994 (45%) Gaps:245/994 (25%)


  Fly     3 LLSKCFPCFKFK-REEVIDKLDYSNTPLTDFP-EVWQHERTLEELYLSTTRLQALPPQLFYCQGL 65
            |:.:..||..|: .||:|..||||:..|...| ||:..|||||||||...:::.||.|||.||.|
Mouse    45 LIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEELPKQLFNCQAL 109

  Fly    66 RVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITS 130
            |.|.:..|:|.|:|.:|.||..|:.||:::|.:...||.||.||.||.::.|.|.:.:|||..|.
Mouse   110 RKLSIPDNDLSSLPTSIASLVNLKELDISKNGVQEFPENIKCCKCLTIIEASVNPISKLPDGFTQ 174

  Fly   131 LISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPE 195
            |::|.:|.||:.:||||||||||||.|||||||.|:|.||||||.:|..|:|||:|.|||:||||
Mouse   175 LLNLTQLYLNDAFLEFLPANFGRLVKLRILELRENHLKTLPKSMHKLAQLERLDLGNNEFSELPE 239

  Fly   196 VVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLE 260
            |:.::::|||||:|.|.::.:..:||||:.|.:.:.:.|.::|:..::|....:|.|.:.||.|:
Mouse   240 VLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQ 304

  Fly   261 AFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADD 325
            ..|.|:|:||.|.|.|.:.|.||.||::|..|..|||...|.|:|..||.|||.|.|||.|..|:
Mouse   305 QLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEEFDCSCNELESLPPTIGYLHSLRTLAVDE 369

  Fly   326 NQLRQLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSM 390
            |.|.:||.|:.||:.::|:|:.:|:|..||:.||.:.:::|||:.:|.:..||.|...|..|.::
Mouse   370 NFLPELPREIGSCKNVTVMSLRSNKLEFLPEEIGQMQRLRVLNLSDNRLKNLPFSFTKLKELAAL 434

  Fly   391 WLSDNQSQPLVPLQYLDASTKTQ---LTCFMLPQ-----VTFKMNS---------IQAQQQAQEQ 438
            |||||||:.|:||| .:|..:|:   ||.:|.||     ..|:.:|         .|.||:....
Mouse   435 WLSDNQSKALIPLQ-TEAHPETKQRVLTNYMFPQQPRGDEDFQSDSDSFNPTLWEEQRQQRMTVA 498

  Fly   439 YEFVYANQQQPHASPSRRI-----------------------CFAEEATILSNAKAQPAPN---- 476
            :||....:....|...:.:                       |....|......:..|.|.    
Mouse   499 FEFEDKKEDDESAGKVKALSCQAPWDRGQRGITLQPARLSGDCCTPWARCDQQIQDMPVPQSDPQ 563

  Fly   477 ----------------YPSFVAAPPTPTPDQMAG---SVRLMRSPTPYPKELRQMSKYVR----- 517
                            .|..|||..|..| .::|   .:.|.|.|||||::|:.|.|.|:     
Mouse   564 LAWGCISGLQQERSMCAPLPVAAQSTTLP-SLSGRQVEINLKRYPTPYPEDLKNMVKSVQNLVGK 627

  Fly   518 -----QAQAATSSANASE-----------------------VREARVVTNGQI------------ 542
                 :.:.:..:||..:                       |..|..:..|::            
Mouse   628 PSHGVRVENSNPTANTEQTVKEKFEHKWPVAPKEITVEDSFVHPANEMRIGELHPSLAETPLYPP 692

  Fly   543 ---------------------HCDSNNANQDVV-----DQATTS---------AIYGIAPETTH- 571
                                 ||.:|:.:....     .||:::         ::...|.:..| 
Mouse   693 KLVLLGKDKKESTDESEVDKTHCLNNSVSSGTYSDYSPSQASSASSNTRMKVGSLQATAKDAVHN 757

  Fly   572 -IYGVYQQPQQMAHPVPTQEYYGLPLVNYE----------------------------AHYQQ-- 605
             ::|     .::|.|.| |.....||::..                            :||..  
Mouse   758 SLWG-----NRIAPPFP-QPLDAKPLLSQREAVPPGNIPQRPDRLPMSDAFPDNWTDGSHYDNTG 816

  Fly   606 -LYVEA------NTPLPTTHLNGDQDYELQPLQQQ------PM---QQQALPTPRLEPPPYHIAR 654
             :..||      |.||.::.......:..:||.:|      |:   |.....||..|.||.:..:
Mouse   817 FVSEEAAGENANNNPLLSSKARSVPAHGRRPLIRQERIVGVPLELEQSTHRHTPETEVPPSNPWQ 881

  Fly   655 VYTKKTP---EDLNLYES----------MRQRKQQQQLQEQT----------IYQDALNSNSNFK 696
            .:| :||   ||...:.|          :.:||...:...:|          .|.|...:.|...
Mouse   882 NWT-RTPSPFEDRTAFPSKLETTPTTSPLPERKDHMKEPTETPGPFSPGVPWEYHDPTPNRSLGN 945

  Fly   697 T---------TAIGAQDVEESVDQLDYQNNISNNLEPNPEEEDQELD--DTMSQHSLNSTATNNT 750
            .         ::.|...:.:|.::|   :.:..:::.|..::.|.:|  |..:....|....|..
Mouse   946 VFSQIHCRPDSSKGVIAISKSTERL---SPLMKDIKSNKFKKSQSIDEIDVGTYKVYNIPLENYA 1007

  Fly   751 SKASHKKSTWIFGVHKNP 768
            |.:.|      .|.|:.|
Mouse  1008 SGSDH------LGSHERP 1019

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 98/180 (54%)
leucine-rich repeat 21..41 CDD:275380 10/21 (48%)
LRR_8 40..98 CDD:290566 29/58 (50%)
leucine-rich repeat 42..64 CDD:275380 13/22 (59%)
leucine-rich repeat 65..87 CDD:275380 10/22 (45%)
LRR_8 86..140 CDD:290566 22/54 (41%)
leucine-rich repeat 88..110 CDD:275380 10/22 (45%)
leucine-rich repeat 111..133 CDD:275380 9/22 (41%)
leucine-rich repeat 134..156 CDD:275380 16/22 (73%)
LRR_8 156..213 CDD:290566 36/57 (63%)
leucine-rich repeat 157..179 CDD:275380 16/22 (73%)
leucine-rich repeat 180..202 CDD:275380 13/22 (59%)
leucine-rich repeat 203..225 CDD:275380 11/22 (50%)
leucine-rich repeat 226..248 CDD:275380 4/22 (18%)
leucine-rich repeat 272..294 CDD:275380 10/22 (45%)
LRR_8 279..328 CDD:290566 25/49 (51%)
leucine-rich repeat 295..317 CDD:275380 12/22 (55%)
leucine-rich repeat 318..340 CDD:275380 11/22 (50%)
LRR_8 340..396 CDD:290566 22/56 (39%)
leucine-rich repeat 364..386 CDD:275380 8/22 (36%)
PDZ_signaling 770..846 CDD:238492
Lrrc7NP_001357710.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BA7S
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 405 1.000 Inparanoid score I1880
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005840
OrthoInspector 1 1.000 T616391
orthoMCL 1 0.900 OOG5_133203
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.929 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.