DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and let-413

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_001023851.1 Gene:let-413 WormBaseID:WBGene00002632 Length:699 Species:Caenorhabditis elegans

Alignment Length:857 Identity:231/858 (27%)
Similarity:342/858 (40%) Gaps:210/858 (24%)


  Fly     1 MPLLSKCFPCFKFKREEVIDKLDYSNTPLTDFPEVWQHERTLEELYLSTTRLQALPPQLFYCQGL 65
            ||    .|.|.....:..:|.:|.|.:.|...|......|.||:|.|:...::.|..:||..:.|
 Worm     1 MP----AFFCLPMACQRQVDSIDRSQSNLQAIPSDIFRFRKLEDLNLTMNNIKELDHRLFSLRHL 61

  Fly    66 RVLHVNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITS 130
            |:|.|:.|.|..:|..||:|.||..|:||||.|..:|:.:::||.||.|:||.|...|||:.|..
 Worm    62 RILDVSDNELAVLPAEIGNLTQLIELNLNRNSIAKLPDTMQNCKLLTTLNLSSNPFTRLPETICE 126

  Fly   131 LISLQELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPE 195
            ..|:..|.||||.|..||:|.|.|.|||:||.|.|.|.|:|.|:|.|..|:.||:|.||...||.
 Worm   127 CSSITILSLNETSLTLLPSNIGSLTNLRVLEARDNLLRTIPLSIVELRKLEELDLGQNELEALPA 191

  Fly   196 VVGELKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLE 260
            .:|:|.||||.::|.|.:..:..:|...|.|...:.:.|.:..||..|....|:..|:|..|.:.
 Worm   192 EIGKLTSLREFYVDINSLTSLPDSISGCRMLDQLDVSENQIIRLPENLGRMPNLTDLNISINEII 256

  Fly   261 AFPFSVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADD 325
            ..|.|.|.||.|...|.:.|.|..|...|...:.|.||.|..|.|..||.|||.||.|..|..|.
 Worm   257 ELPSSFGELKRLQMLKADRNSLHNLTSEIGKCQSLTELYLGQNFLTDLPDTIGDLRQLTTLNVDC 321

  Fly   326 NQLRQLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSM 390
            |.|..:||.:.:|:.|:|||:..|.|:.||..||....:.||:|.:|.:..||.::..|..|.::
 Worm   322 NNLSDIPDTIGNCKSLTVLSLRQNILTELPMTIGKCENLTVLDVASNKLPHLPFTVKVLYKLQAL 386

  Fly   391 WLSDNQSQPLVPLQYL--DASTKTQLTCFMLPQVTFKMNSIQAQQQAQEQYEFVYANQQQPHASP 453
            |||:||:|.::.|...  |......:||::||||    ::|..:.:                   
 Worm   387 WLSENQTQSILKLSETRDDRKGIKVVTCYLLPQV----DAIDGEGR------------------- 428

  Fly   454 SRRICFAEEATILSNAKAQPAPNYPSFVAAPPTPTPDQMAGSVRLMRSPTPYPKELRQMSKYVRQ 518
                          :..||...:..:|:..|.....||                           
 Worm   429 --------------SGSAQHNTDRGAFLGGPKVHFHDQ--------------------------- 452

  Fly   519 AQAATSSANASEVREARVVTNGQIHCDSNNANQDVVDQATTSAIYGIAPETTHIYGVYQQPQQMA 583
                 :.....|.:||      :||                                        
 Worm   453 -----ADTTFEENKEA------EIH---------------------------------------- 466

  Fly   584 HPVPTQEYYGLPLVNYEAHYQQLYVEANTPLPTT--HLNGDQDYELQPLQQQPMQQQALPTPRLE 646
                        |.|:|.|        |||.|.|  |..|..|..:.|        ..:..||  
 Worm   467 ------------LGNFERH--------NTPHPKTPKHKKGSIDGHMLP--------HEIDQPR-- 501

  Fly   647 PPPYHIARVYTKKTPEDLNLYESMRQRKQQQQLQEQTIYQDALNSNSNFKTTAIG--AQDVEESV 709
                                                   |.:|.||....|::.|  :..:...:
 Worm   502 ---------------------------------------QLSLVSNHRTSTSSFGESSNSINRDL 527

  Fly   710 DQLDYQNNISN-NLEPNPEEEDQELDDTMSQHSLNSTATNNTSKASHKKSTWIFGVHKNPTVKQV 773
            ..:..||.:.. .|.|   |.::.:..::|..|..:..|.|..         ...:.|:.|.| :
 Worm   528 ADIRAQNGVREATLSP---EREERMATSLSSLSNLAAGTQNMH---------TIRIQKDDTGK-L 579

  Fly   774 TLKWENSIGFDIAELLN-QVGIFVSSITPNTNAARL-LNLNDKLLEIDGYDLTNANLSDAKRVLL 836
            .|.:......|.|...| ..|:||:.:||.:.|.|. |...|||:..:..::.||:..:|...:.
 Worm   580 GLSFAGGTSNDPAPNSNGDSGLFVTKVTPGSAAYRCGLREGDKLIRANDVNMINASQDNAMEAIK 644

  Fly   837 NCGTVMNIMLSR 848
            ...||..::|.|
 Worm   645 KRETVELVVLRR 656

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 77/179 (43%)
leucine-rich repeat 21..41 CDD:275380 5/20 (25%)
LRR_8 40..98 CDD:290566 25/58 (43%)
leucine-rich repeat 42..64 CDD:275380 7/22 (32%)
leucine-rich repeat 65..87 CDD:275380 10/22 (45%)
LRR_8 86..140 CDD:290566 24/54 (44%)
leucine-rich repeat 88..110 CDD:275380 10/22 (45%)
leucine-rich repeat 111..133 CDD:275380 10/22 (45%)
leucine-rich repeat 134..156 CDD:275380 11/22 (50%)
LRR_8 156..213 CDD:290566 29/57 (51%)
leucine-rich repeat 157..179 CDD:275380 12/22 (55%)
leucine-rich repeat 180..202 CDD:275380 10/22 (45%)
leucine-rich repeat 203..225 CDD:275380 7/22 (32%)
leucine-rich repeat 226..248 CDD:275380 5/22 (23%)
leucine-rich repeat 272..294 CDD:275380 6/22 (27%)
LRR_8 279..328 CDD:290566 21/49 (43%)
leucine-rich repeat 295..317 CDD:275380 13/22 (59%)
leucine-rich repeat 318..340 CDD:275380 8/22 (36%)
LRR_8 340..396 CDD:290566 22/56 (39%)
leucine-rich repeat 364..386 CDD:275380 7/22 (32%)
PDZ_signaling 770..846 CDD:238492 21/78 (27%)
let-413NP_001023851.1 LRR_8 13..71 CDD:290566 18/58 (31%)
LRR_RI 37..349 CDD:238064 128/312 (41%)
leucine-rich repeat 38..60 CDD:275380 7/22 (32%)
LRR_8 59..117 CDD:290566 27/58 (47%)
leucine-rich repeat 61..83 CDD:275380 10/22 (45%)
leucine-rich repeat 84..106 CDD:275380 10/22 (45%)
leucine-rich repeat 107..129 CDD:275380 10/22 (45%)
LRR_8 128..186 CDD:290566 31/58 (53%)
leucine-rich repeat 130..152 CDD:275380 11/22 (50%)
leucine-rich repeat 153..175 CDD:275380 12/22 (55%)
LRR_8 174..232 CDD:290566 20/58 (34%)
leucine-rich repeat 176..198 CDD:275380 10/22 (45%)
leucine-rich repeat 199..221 CDD:275380 7/22 (32%)
leucine-rich repeat 222..244 CDD:275380 5/22 (23%)
leucine-rich repeat 245..265 CDD:275380 6/20 (30%)
leucine-rich repeat 268..290 CDD:275380 6/22 (27%)
leucine-rich repeat 291..313 CDD:275380 13/22 (59%)
LRR_8 312..370 CDD:290566 23/58 (40%)
leucine-rich repeat 314..336 CDD:275380 8/22 (36%)
leucine-rich repeat 360..382 CDD:275380 7/22 (32%)
PDZ_signaling 567..654 CDD:238492 23/97 (24%)
DegQ <590..659 CDD:223343 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BA7S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.860

Return to query results.
Submit another query.