DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lap1 and Scrib

Sequence 1:NP_001188938.1 Gene:Lap1 FlyBaseID:FBgn0033984 Length:849 Species:Drosophila melanogaster
Sequence 2:NP_598850.1 Gene:Scrib MGIID:2145950 Length:1665 Species:Mus musculus

Alignment Length:910 Identity:258/911 (28%)
Similarity:402/911 (44%) Gaps:178/911 (20%)


  Fly     6 KCFPCFKFKREEVIDKLDYSNTPLTDFP-EVWQHERTLEELYLSTTRLQALPPQLFYCQGLRVLH 69
            ||.|.::..|.  ::.:|..:..|...| |::::.|:||||.|...:|:.||...|....||.|.
Mouse     3 KCIPLWRCNRH--VESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLG 65

  Fly    70 VNSNNLESIPQAIGSLRQLQHLDLNRNLIVNVPEEIKSCKHLTHLDLSCNSLQRLPDAITSLISL 134
            ::.|.::.:|..:.:..||..||::||.|..:||.||.||.|...|.|.|.|.||||..|.|.||
Mouse    66 LSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSL 130

  Fly   135 QELLLNETYLEFLPANFGRLVNLRILELRLNNLMTLPKSMVRLINLQRLDIGGNEFTELPEVVGE 199
            ..|.||:..|:.||.:.|.|.||..||||.|.|.:||.|:..|:.|::||:|||:...||:.:|.
Mouse   131 AHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGA 195

  Fly   200 LKSLRELWIDFNQIRRVSANIGKLRDLQHFEANGNLLDTLPSELSNWRNVEVLSICSNSLEAFPF 264
            |.:|||||:|.||:..:...:|.||.|...:.:.|.|:.||.||.....:..|.:..|.|:..|.
Mouse   196 LPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPE 260

  Fly   265 SVGMLKSLVTFKCESNGLTELPDSISYLEQLEELVLSHNKLIRLPSTIGMLRSLRFLFADDNQLR 329
            .:|.||.|...|.:.|.|.|:.::|...|.|.||:|:.|.|..||.::|.|..|..|..|.|.|.
Mouse   261 GIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLE 325

  Fly   330 QLPDELCSCQQLSVLSVANNQLSALPQNIGNLSKMKVLNVVNNYINALPVSMLNLVNLTSMWLSD 394
            .||.|:..|..|||||:.:|:|:.||..:.:.:::.||:|..|.:.:||.::.:| ||.::||::
Mouse   326 VLPPEIGGCVALSVLSLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHL-NLKALWLAE 389

  Fly   395 NQSQPLVPLQYL-DAST-KTQLTCFMLPQVTFKMNSIQAQQQAQEQYEFVYANQQQPHAS----P 453
            ||:||::..|.. ||.| :..|||::|||     ..:.:.:.|        ..|..|..|    |
Mouse   390 NQAQPMLRFQTEDDAQTGEKVLTCYLLPQ-----QPLPSLEDA--------GQQSSPSESCSDAP 441

  Fly   454 SRRICFAE-EATILSNAKAQPAPNYPSFVAAPPTPTPDQMAGSVR-LMRSPTPYPKELRQMSKYV 516
            ..|:...: |.|:.....|:.|                  |...| |.|..||:|.||:.|.:.:
Mouse   442 LSRVSVIQFEDTLEGEEDAEEA------------------AAEKRGLQRRATPHPSELKVMKRGI 488

  Fly   517 RQAQ----------------------AATSSANASEVREARVVTNGQIHCDSNNANQDVVDQATT 559
            .:.:                      :|.|:.:...|..|...:.|:                  
Mouse   489 EERRNEAFVCKPDPSPPSPSEEEKRLSAESALSGGSVPSASTASEGE------------------ 535

  Fly   560 SAIYGIAPE--TTHIYGVYQQPQQMAHPVPTQEYYGLPLVNY---------EAHYQQLYVEANTP 613
                   ||  ...:.|:.|.....|....|::.|..|.|::         :...::...||..|
Mouse   536 -------PEILPAEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLIPREDGESEEGQPEAAWP 593

  Fly   614 LP----------TTHLNGDQDYELQPLQQQPMQQQAL----------PTPRLEPPPY--HIARVY 656
            ||          |.|..  :.:::..| .||....||          ||......|:  ...|.:
Mouse   594 LPSGRQRLIRKDTPHYK--KHFKISKL-PQPEAVVALLQGVQTDREGPTAGWHNGPHTPWAPRAH 655

  Fly   657 TKKTPEDLNLYESMRQRKQQQQLQEQTIYQDALNSNSNFKTTAIGAQDVEESVDQLDYQNNISNN 721
            .::..|:    |..|..::.:...|:...::|:.|..:.|..         |.||       :||
Mouse   656 EEEEEEE----EENRDEEEGEATTEEDDKEEAVASAPSVKGV---------SFDQ-------ANN 700

  Fly   722 LEPNPEE-EDQELDDTMSQHSLNSTATNNTSKASHKKSTWIFGVHKNPTVKQVTLKWENSIGFDI 785
            |...|.. |::||..|:    :..|.....|.|..|.||...|                      
Mouse   701 LLIEPARIEEEELTLTI----VRQTGGLGISIAGGKGSTPYKG---------------------- 739

  Fly   786 AELLNQVGIFVSSITPNTNAARL-LNLNDKLLEIDGYDLTNANLSDAKRVLLNCGTVMNIMLSRK 849
                :..|||:|.::....|||. :.:.|||||::|..|.:|...:|...|...|..:.:.:.|:
Mouse   740 ----DDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQDAEHHEAVEALRGAGAAVQMRVWRE 800

  Fly   850  849
            Mouse   801  800

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lap1NP_001188938.1 LRR_RI <21..200 CDD:238064 74/180 (41%)
leucine-rich repeat 21..41 CDD:275380 5/21 (24%)
LRR_8 40..98 CDD:290566 21/58 (36%)
leucine-rich repeat 42..64 CDD:275380 9/22 (41%)
leucine-rich repeat 65..87 CDD:275380 5/22 (23%)
LRR_8 86..140 CDD:290566 28/54 (52%)
leucine-rich repeat 88..110 CDD:275380 12/22 (55%)
leucine-rich repeat 111..133 CDD:275380 11/22 (50%)
leucine-rich repeat 134..156 CDD:275380 9/22 (41%)
LRR_8 156..213 CDD:290566 30/57 (53%)
leucine-rich repeat 157..179 CDD:275380 11/22 (50%)
leucine-rich repeat 180..202 CDD:275380 10/22 (45%)
leucine-rich repeat 203..225 CDD:275380 11/22 (50%)
leucine-rich repeat 226..248 CDD:275380 7/22 (32%)
leucine-rich repeat 272..294 CDD:275380 7/22 (32%)
LRR_8 279..328 CDD:290566 19/49 (39%)
leucine-rich repeat 295..317 CDD:275380 10/22 (45%)
leucine-rich repeat 318..340 CDD:275380 9/22 (41%)
LRR_8 340..396 CDD:290566 21/56 (38%)
leucine-rich repeat 364..386 CDD:275380 7/22 (32%)
PDZ_signaling 770..846 CDD:238492 18/77 (23%)
ScribNP_598850.1 LRR_RI 12..232 CDD:238064 89/222 (40%)
leucine-rich repeat 14..37 CDD:275380 5/23 (22%)
leucine-rich repeat 38..60 CDD:275380 9/22 (41%)
LRR 39..405 CDD:227223 147/367 (40%)
leucine-rich repeat 61..83 CDD:275380 5/22 (23%)
leucine-rich repeat 84..106 CDD:275380 12/22 (55%)
leucine-rich repeat 107..129 CDD:275380 11/22 (50%)
leucine-rich repeat 130..152 CDD:275380 9/22 (41%)
leucine-rich repeat 153..175 CDD:275380 11/22 (50%)
leucine-rich repeat 176..198 CDD:275380 10/22 (45%)
leucine-rich repeat 199..221 CDD:275380 11/22 (50%)
leucine-rich repeat 268..290 CDD:275380 7/22 (32%)
LRR_4 289..329 CDD:289563 18/40 (45%)
leucine-rich repeat 291..313 CDD:275380 10/22 (45%)
leucine-rich repeat 314..336 CDD:275380 9/22 (41%)
leucine-rich repeat 360..381 CDD:275380 7/22 (32%)
PDZ 711..799 CDD:214570 28/118 (24%)
PDZ_signaling 854..933 CDD:238492
PDZ_signaling 988..1076 CDD:238492
PDZ_signaling 1085..1175 CDD:238492
AbLIM_anchor 1565..>1659 CDD:292800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BA7S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D148064at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.