DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and CYP86B1

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_197710.1 Gene:CYP86B1 AraportID:AT5G23190 Length:559 Species:Arabidopsis thaliana

Alignment Length:547 Identity:129/548 (24%)
Similarity:224/548 (41%) Gaps:98/548 (18%)


  Fly     9 QVAVALLAILTYYIHRKLTYFKRRGIPFVAPHL---------IRGNMEE-------LQKTKNIHE 57
            |:...|:||..:.....|...|.:|:| |.|.|         :|||:.|       ||     :.
plant    37 QILELLIAIFVFVAIHALRQKKYQGLP-VWPFLGMLPSLAFGLRGNIYEWLSDVLCLQ-----NG 95

  Fly    58 IFQDHYNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHLF 122
            .||            |.|.:|....:....|....:.:|...||.|.....|.:...|.:...:|
plant    96 TFQ------------FRGPWFSSLNSTITCDPRNVEHLLKNRFSVFPKGSYFRDNLRDLLGDGIF 148

  Fly   123 NLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVS----VANEFMTVMHEKVPKNSVLEIRDLVARFT 183
            |.|...|:..|...|..|.|.|.:.:  |..|    |....:.|:...|..:|.::::|::.|.|
plant   149 NADDETWQRQRKTASIEFHSAKFRQL--TTQSLFELVHKRLLPVLETSVKSSSPIDLQDVLLRLT 211

  Fly   184 VDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLN--------GFMRSYPKLARKLGMV 240
            .|.:...|||:....|..:: ..:.|.| :..|.....::.        .||| |..:..:..:.
plant   212 FDNVCMIAFGVDPGCLGPDQ-PVIPFAK-AFEDATEAAVVRFVMPTCVWKFMR-YLDIGTEKKLK 273

  Fly   241 RTAPHIQEFYSRIVTETVAVREK------EHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEE 299
            .:...:.:|    ..|.:..|:|      |..||:|.:.:.:.|:::|      |:......:.:
plant   274 ESIKGVDDF----ADEVIRTRKKELSLEGETTKRSDLLTVFMGLRDEK------GESFSDKFLRD 328

  Fly   300 VLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQN-----------FTY 353
            :...   |.:||.:|||..:.:..:.|.|||::::|:..|:.:::.|.|.:           |..
plant   329 ICVN---FILAGRDTSSVALSWFFWLLEKNPEVEEKIMVEMCKILRQRDDHGNAEKSDYEPVFGP 390

  Fly   354 ECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIY- 417
            |..|.:.||...|.|.||||..||...:...:..|.|  ...:::.|..||....|:....:|: 
plant   391 EEIKKMDYLQAALSEALRLYPSVPVDHKEVQEDDVFP--DGTMLKKGDKVIYAIYAMGRMEAIWG 453

  Fly   418 PEPFEFRPERFSPE-----ESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTC 477
            .:..||||||:..:     |||.:    :..|..|||.|:|..|...|.:...|.::..:|.   
plant   454 KDCLEFRPERWLRDGRFMSESAYK----FTAFNGGPRLCLGKDFAYYQMKSTAAAIVYRYKV--- 511

  Fly   478 SKTPNPLVYDPK-SFVLGVKDGIYLKV 503
             |..|....:|| :..:.:|.|:.:.:
plant   512 -KVVNGHKVEPKLALTMYMKHGLMVNL 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 120/516 (23%)
CYP86B1NP_197710.1 PLN03195 38..541 CDD:215627 128/547 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.