DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and CYP709B2

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana

Alignment Length:532 Identity:137/533 (26%)
Similarity:232/533 (44%) Gaps:110/533 (21%)


  Fly     4 TYILFQVAVALLAILTYY------------IHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIH 56
            |..|..:|:.||.:...|            :.|:   ||::||......::.||:.|::|.||..
plant    61 TINLLAIALVLLVVPKIYGACRILVWRPWMLSRR---FKKQGISGPKYRILYGNLREIRKMKNEA 122

  Fly    57 EI-----------------FQDHYNKFRESKAPFVGFFFFQ--SPAAFVIDLELAKQILIKDFSN 102
            ::                 .|...:::.|:      |.::|  .|...:.|.|||||||      
plant   123 KLMVLDPNSNDIVPRVLPHLQQWKSQYGET------FLYWQGTDPRLCISDHELAKQIL------ 175

  Fly   103 FSNKGIFYNE-KDDP----ISAH-LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMT 161
             |||.:|::: |..|    :|.: |..::|..|...|..|:..|:..|:|||  |.:.|...|..
plant   176 -SNKFVFFSKSKTKPEILKLSGNGLIFVNGLDWVRHRRILNPAFSMDKLKLM--TQLMVDCTFRM 237

  Fly   162 VMHEKVPKNSVLEIRDLV------ARFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSL-VDKRH 219
            .:..|..:|.| |....|      .|.|.|:|.|.|||       ...||.:...|..| :.|..
plant   238 FLEWKKQRNGV-ETEQFVLISREFKRLTADIIATAAFG-------SSYAEGIEVFKSQLELQKCC 294

  Fly   220 GTLLNGFM---RSYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQ 281
            ...|....   ..|......|.:.:....:.....||:...:....|::  .||.:.:::...:.
plant   295 AAALTDLYFPGIQYLPTPSNLQIWKLDMKVNSSIKRIIDARLTSESKDY--GNDLLGIMLTAASS 357

  Fly   282 KEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQ 346
            .|..       :.::::|::.:...||.||.||:::.:.::...|:.:.|.|:|:|.||..    
plant   358 NESE-------KKMSIDEIIEECKTFFFAGHETTANLLTWSTMLLSLHQDWQEKLREEVFN---- 411

  Fly   347 HDQNFTYECTKD----------LKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQ 401
                   ||.||          ||.:|.|..|:||||..|.||.|:|::...:   .|..|..|.
plant   412 -------ECGKDKIPDAETCSKLKLMNTVFMESLRLYGPVLNLLRLASEDMKL---GNLEIPKGT 466

  Fly   402 SVIIPSSAIHHDPSIY-PEPFEFRPERFSP--EESAGRPSVAWLPFGDGPRNCIGLRFGQMQARI 463
            ::|:|.:.:|.|.::: .:..:|.|.||:.  ..:|..|: |.|.|..|||.|||..|..|:|:.
plant   467 TIILPIAKMHRDKAVWGSDADKFNPMRFANGLSRAANHPN-ALLAFSMGPRACIGQNFAIMEAKT 530

  Fly   464 GLALLIRNFKFS 475
            .||::::.|:.:
plant   531 VLAMILQRFRLN 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 126/486 (26%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 131/505 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.