DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp3c2

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_021330384.1 Gene:cyp3c2 ZFINID:ZDB-GENE-081103-62 Length:503 Species:Danio rerio

Alignment Length:510 Identity:149/511 (29%)
Similarity:262/511 (51%) Gaps:48/511 (9%)


  Fly     1 MALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNK 65
            :::|:||..:.:.||.:...:.|   .:||:.|||...|....|..  |..||.......:...|
Zfish     7 LSVTWILVVLVLTLLYMYGVWPH---GFFKKLGIPGPRPWPFFGTF--LSYTKGFFNFDMECAKK 66

  Fly    66 FRESKAPFVGFFFFQSPAAFVIDLELAKQILIKD-FSNFSNKGIFYNEKDDPISAHLFNLDGAQW 129
            :    ....|.:..:.|...|.|||:.|.|::|: :|.|:|:.....:...|::..:..:...:|
Zfish    67 Y----GKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREINVDLAGPLADGITAVKDERW 127

  Fly   130 RLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAFGI 194
            :.:|..||..||||::|.::|..::.|:.|:..| :|......::|::::|.:::||:.:.||.:
Zfish   128 KRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNM-QKGDHEQPVKIKEVMASYSLDVVTSSAFSV 191

  Fly   195 QCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVR----TAPHIQEFYSRIVT 255
            ..:|:.:....|:...|..|.....| |....:..:|.:|..||.:.    :.|.:..||..:  
Zfish   192 DIDSINNPDDPFVTNIKNFLKFNLFG-LFVLLLTVFPSIANLLGKMGLSMFSKPTVDFFYKAL-- 253

  Fly   256 ETVAVREKEHIKRNDFMDMLIELKNQ------KEMTLENGDVVRGLTMEEVLAQAFVFFIAGFET 314
            ..:....|:...|.||..::|:  |:      |:.|.|..:  :|||..|:|:|:|:|.:.|:||
Zfish   254 RKIKEEHKDSNGRVDFFRLMIQ--NEIPDDQVKDTTSEQPE--KGLTDHEILSQSFIFIMGGYET 314

  Fly   315 SSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNF------TYECTKDLKYLNQVLDETLRLY 373
            :|:|:.|.||.||.|||.       :|:::|:.|:||      :|:....:.||...::|::||.
Zfish   315 TSTTLTFLLYNLAINPDC-------LEKLVEKIDKNFPLDTPISYDALMKIDYLEMSINESMRLL 372

  Fly   374 TIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPS 438
            ...|.|:|:..|...:.|   ..|.....:.||:..::.||.::..|.||||||||||..:....
Zfish   373 PTAPRLERVCKKTVEMNG---ITIPKDTMITIPTYVLNQDPQLWDSPHEFRPERFSPENKSEFLQ 434

  Fly   439 VAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPL----VYDPK 489
            .|::|||.|||||||:|:..|..::.:..|::||...||.:|..||    |:.||
Zfish   435 YAFMPFGLGPRNCIGMRYALMIVKLLVVKLLQNFSVETCKETQIPLELNPVFQPK 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 138/473 (29%)
cyp3c2XP_021330384.1 p450 38..496 CDD:306555 139/477 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3274
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128698
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.