DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp3a65

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001032515.1 Gene:cyp3a65 ZFINID:ZDB-GENE-050604-1 Length:517 Species:Danio rerio

Alignment Length:532 Identity:152/533 (29%)
Similarity:257/533 (48%) Gaps:65/533 (12%)


  Fly     2 ALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIR--GNMEELQKTKNIHEIFQDHYN 64
            |.|:.|.....|||.|...:.||   |||:.|||  .|..|.  |.|  |:.....|....|.:.
Zfish     5 AETWTLLAFLAALLVIYGSWPHR---YFKKLGIP--GPKAIPFFGTM--LRYKDGFHVFDMDCFE 62

  Fly    65 KFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKD-FSNFSNK------GIFYN-----EKDDPI 117
            |:    ....|.:..:.|...::|..:.|.:|||: :|.|:|:      |..|:     |.||  
Zfish    63 KY----GRIWGIYDGRQPVLCIMDQTIIKTVLIKECYSLFTNRRNFRLNGALYDAVSIAEDDD-- 121

  Fly   118 SAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARF 182
                       ||.:|:.||.:||||::|.|:..:...::..:..|.:...:....:|::....:
Zfish   122 -----------WRRIRSVLSPSFTSGRLKEMFGIMKKHSHILVDSMGKTAKRGESADIKEFFGAY 175

  Fly   183 TVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNG---FMRSYPKLA---RKLGMVR 241
            ::||:.:.||.:..:||.:.|..|:...|:.|    ...|||.   .:..:|.:|   .|:....
Zfish   176 SMDVVTSTAFSVDIDSLNNPKDPFVTNIKKML----KFDLLNPLFLLIAFFPFMAPVLEKMDFAL 236

  Fly   242 TAPHIQEFYSRIV--------TETVAVREKEHI-KRNDFMDMLIELKNQKEMTLENGDVVRGLTM 297
            ....:.:|:...:        |:|||   |::. ||.||:.::::.:...:...:.....:||:.
Zfish   237 FPTSVTDFFYAALQKIKSDRDTKTVA---KDNTKKRVDFLQLMVDSQTGVKHKSDGEHTEKGLSD 298

  Fly   298 EEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYL 362
            .|:|:|:.:|..||:||||||:.|..|.||.||:...|::.|::|.. .:.....||....:.||
Zfish   299 HEILSQSMIFIFAGYETSSSTLSFLFYNLATNPETMKKLQEEIDETF-PNQAPVDYETLMSMDYL 362

  Fly   363 NQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPER 427
            :..|.|:|||:.:...|:|:..|...:.|   .:|.....|::|:.|:|.||..:.||..|:|||
Zfish   363 DAALSESLRLFPVAARLERVCKKTVEING---LLIPKDLVVMVPTYALHRDPDYWSEPESFKPER 424

  Fly   428 FSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFV 492
            |:...........::|||.|||||||:||.|:..::.:..:::.|..|.|.:|..||...... :
Zfish   425 FTKGNKESIDPYMYMPFGLGPRNCIGMRFAQVTMKLAIVEILQRFDVSVCDETQVPLELGFNG-L 488

  Fly   493 LGVKDGIYLKVE 504
            |..||.|.||::
Zfish   489 LSPKDPIKLKLQ 500

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 137/493 (28%)
cyp3a65NP_001032515.1 p450 35..499 CDD:278495 138/497 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.