DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and Cyp6w1

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001286145.1 Gene:Cyp6w1 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster

Alignment Length:520 Identity:187/521 (36%)
Similarity:292/521 (56%) Gaps:47/521 (9%)


  Fly    14 LLAILT--YYI--HRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRES----K 70
            ||..||  :||  .|.|::::|.|:.::.|..:.|...|....|   ..|.:...||.|:    .
  Fly     6 LLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAK---VPFFEQIQKFHEAPGFEN 67

  Fly    71 APFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPIS-AHLFNLDGAQWRLLRN 134
            .||||.:....||..:.||||.|.::||.|..|:|:.:..:..:|.:. .:||......||.||.
  Fly    68 EPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLFFARSPGWRELRT 132

  Fly   135 KLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAFGIQCNSL 199
            |:|..|||||:|.|||.:|.:...... ..|::...:.::::||.:|||.|:|.|.|||::.|:|
  Fly   133 KISPVFTSGKIKQMYPLMVKIGKNLQD-SAERLGSGTEVQVKDLCSRFTTDLIATIAFGVEANAL 196

  Fly   200 RDEKAEFLYFGKR--SLVDKRHGTLLNG------FM-RSYPKLAR-KLGMVRTAPHIQEFYSRIV 254
            :|.|:||.|..:.  ||      ||..|      || .:...||| ||....|...|:...:.::
  Fly   197 QDAKSEFFYHNRAIFSL------TLSRGIDFAIIFMIPALASLARVKLFSRETTKFIRSSVNYVL 255

  Fly   255 TETVAVREKEHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTM 319
            .|    ||:...||||.:|:|:.||  :|.....|.:.:.:.::.::|||.||..||||||:|||
  Fly   256 KE----RERTGEKRNDLIDILLALK--REAAANPGKMSKEVDLDYLVAQAAVFQTAGFETSASTM 314

  Fly   320 GFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAA 384
            ...|||||||..:||::|.|:.:.....| :.:||..:::.||:||::||||.|.||..::|..:
  Fly   315 TMTLYELAKNEALQDRLRQEIVDFFGDED-HISYERIQEMPYLSQVVNETLRKYPIVGYIERECS 378

  Fly   385 -----KRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSV---AW 441
                 :|:.:....|..:..|.|:.:.:.|:|.||..:|:|.::.||||:   |:.|.::   |:
  Fly   379 QPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERFN---SSNRDNLNMDAY 440

  Fly   442 LPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVETV 506
            :|||.|||||||:|.|.:|:::||..::||.:|.||.||...:.:.|.|.|:..|..|.|:||.|
  Fly   441 MPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEWAPTSPVMASKRDIILRVEKV 505

  Fly   507  506
              Fly   506  505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 174/487 (36%)
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 174/487 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51047
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.