DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp3c1

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_997838.1 Gene:cyp3c1 ZFINID:ZDB-GENE-030131-3060 Length:505 Species:Danio rerio

Alignment Length:514 Identity:154/515 (30%)
Similarity:261/515 (51%) Gaps:56/515 (11%)


  Fly     1 MALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNK 65
            :::|:.|..:.:.||.|...:.|   .:||:.|||...|....|.  .|..:|.|.....:...|
Zfish     7 LSVTWTLVVLVITLLLIYGVWPH---GFFKKLGIPGPRPLPFVGT--ALSYSKGICNFDIECSKK 66

  Fly    66 FRESKAPFVGFFFFQSPAAFVIDLELAKQILIKD-FSNFSNKGIFYNEKDDPISAHLFNLDGAQW 129
            :    ....|.:..:.|...|.|||:.|.||:|| :|.|:|:.....:...|.:..:..:...:|
Zfish    67 Y----GKVWGIYDGRLPLLLVTDLEMIKTILVKDCYSTFTNRRNMNPDLVGPFADGITLVKDERW 127

  Fly   130 RLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAFGI 194
            |.:|:.||..||||::|.::|..::.|:.|:..|.:|.| |..|:|:|:||.:::||:.:.:|.:
Zfish   128 RRIRSSLSPYFTSGRLKEIFPIAMTHADRFIKNMEKKDP-NLPLKIKDVVAPYSLDVVASSSFSV 191

  Fly   195 QCNSLRDEKAEFL-----YFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQEFYSRIV 254
            ..:|:.:....|:     :|....|...   .||..|..|...|..|:|:...:....:||.:.:
Zfish   192 DFDSINNPDDPFVTSIKSFFNINPLSPL---FLLLAFCPSAANLLAKMGISVFSRSTTDFYYKAL 253

  Fly   255 TETVAVREKEHIKRN---DFMDMLIELKNQ------KEMTLENGDVVRGLTMEEVLAQAFVFFIA 310
            .:.    :.||.:.|   ||:.::|:  ||      |:...|  ..|:|||..|:|:|:|:|.:.
Zfish   254 RKI----KDEHNESNGRVDFLKLMIQ--NQIPDDQVKDTASE--QPVKGLTDHEILSQSFIFILG 310

  Fly   311 GFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNF------TYECTKDLKYLNQVLDET 369
            |:||:|:|:.:.||.||.|||.       :|:::|:.|:||      ||:....:.||...:.|:
Zfish   311 GYETTSTTLSYLLYNLATNPDC-------LEKLVEEIDKNFPLDIPITYDALMRMDYLEMAIHES 368

  Fly   370 LRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESA 434
            :|::...|.|:|:..|...:.|   ..|.....|.||...:..||.::..|.||:|||||||...
Zfish   369 MRVFPAGPRLERVCKKTVEING---ITIPKNTLVGIPLYVLSRDPDLWESPNEFKPERFSPESKT 430

  Fly   435 GRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPL----VYDPK 489
            .....|::|||.|||||||:||..|..::.:..|::.:...||.:|..|:    .:.||
Zfish   431 EINQCAFMPFGLGPRNCIGMRFALMMMKLLVVKLLQKYTVETCKETQIPVQLNFFFQPK 489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 143/477 (30%)
cyp3c1NP_997838.1 p450 38..496 CDD:278495 144/481 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.