DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and Cyp4f5

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_775147.1 Gene:Cyp4f5 RGDID:708364 Length:526 Species:Rattus norvegicus

Alignment Length:401 Identity:106/402 (26%)
Similarity:190/402 (47%) Gaps:34/402 (8%)


  Fly   121 LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEK-----VPKNSVLEIRDLVA 180
            ||...|.:|...|..|:..|....:|    ..|.:.|:.:.:||.|     :..::.||:.:.::
  Rat   136 LFLSSGDKWSRHRRLLTPAFHFDILK----PYVKIFNQSVNIMHAKWKHLCLEGSARLEMFENIS 196

  Fly   181 RFTVDVIGTCAFGIQCNSLRDEKAEFL--YFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTA 243
            ..|:|.:..|.||...| .::..:|::  .....||:.||...|.......|.:.|......:..
  Rat   197 LMTLDSLQKCLFGFDSN-CQESPSEYISAILELSSLIIKRSQQLFLYLDFLYYRTADGRRFRKAC 260

  Fly   244 PHIQEFYSRIVTETVAVREKEHIKRNDFMDMLIELKNQ-KEMTLENGDVV--------RGLTMEE 299
            ..:..|     |:.| :||:..:..:...|..:|.|.: |..||:..||:        :.|:.|:
  Rat   261 DLVHNF-----TDAV-IRERRRLLSSQGTDEFLESKTKSKSKTLDFIDVLLLAKDEHGKELSDED 319

  Fly   300 VLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVI-EQHDQNFTYECTKDLKYLN 363
            :.|:|..|...|.:|::|.:.:.||.||::|:.|::.|.||.|:: ::..:...::....|.:|.
  Rat   320 IRAEADTFMFGGHDTTASALSWILYNLARHPEYQERCRQEVWELLRDREPEEIEWDDLAQLPFLT 384

  Fly   364 QVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERF 428
            ..:.|:|||:....:|.|...:..|:|  ...||..|...:|....|||:||::|:|..|.|.||
  Rat   385 MCIKESLRLHPPAIDLLRRCTQDIVLP--DGRVIPKGNICVISIFGIHHNPSVWPDPEVFDPFRF 447

  Fly   429 SPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFVL 493
            ..|....|..::::||..|||||||..|...:.::.:||.:..|:.....|.|.    .....:|
  Rat   448 DSENRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVVVALTLLRFRVLPDDKEPR----RKPEIIL 508

  Fly   494 GVKDGIYLKVE 504
            ..:.|::|::|
  Rat   509 RAEGGLWLRME 519

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 105/399 (26%)
Cyp4f5NP_775147.1 p450 52..516 CDD:278495 104/397 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.