DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and Cyp4a12a

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_803125.2 Gene:Cyp4a12a MGIID:88612 Length:508 Species:Mus musculus

Alignment Length:542 Identity:127/543 (23%)
Similarity:230/543 (42%) Gaps:99/543 (18%)


  Fly     1 MALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNK 65
            ::|..:||:.|       ..|:||:......:..|....|.:.|:  ::.|.:::    ||...:
Mouse    25 LSLLLLLFKTA-------QLYLHRQWLLSSTQQFPSPPSHWLFGH--KILKDQDL----QDILTR 76

  Fly    66 FRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDP------------IS 118
            .:...:....:.:.......|.|.:..|.||               .:.||            |.
Mouse    77 IKNFPSACPQWLWGSKVRIQVYDPDYMKLIL---------------GRSDPKANGSYRFLAPWIG 126

  Fly   119 AHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEK----VPKNSVLEIRDLV 179
            ..|..|||..|...|..|:..|....:| .|..:::   :.:.||.:|    |.::|.|||...:
Mouse   127 RGLLMLDGQTWFQHRRMLTPAFHYDILK-PYTEIMA---DSVRVMLDKWEQIVGQDSTLEIFRHI 187

  Fly   180 ARFTVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGF---------------MRS 229
            ...|:|.|..|||..:.:...|.|.:........|.|.....:.|.|               ..|
Mouse   188 TLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNDLVFSRVRNIFHQNDIIYRVSSNGCKANS 252

  Fly   230 YPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHI------KRNDFMDMLIELKNQKEMTLEN 288
            ..|||.        .|..:.   |.:..:.::::|.:      :|.||:|:|:..:      :||
Mouse   253 ACKLAH--------DHTDQV---IKSRRIQLQDEEELEKLKKKRRLDFLDILLFAR------MEN 300

  Fly   289 GDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTY 353
            |   :.|:.:::.|:...|...|.:|::|.:.:..|.||.||:.|.:.|.|::.::.. ..:.|:
Mouse   301 G---KSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGD-GTSITW 361

  Fly   354 ECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYP 418
            .....:.|....:.|.||:|..||::.|..:.....|...:  :..|..|::....:||:|:::|
Mouse   362 NDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRS--LPKGIHVMLSFYGLHHNPTVWP 424

  Fly   419 EPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFK-FSTCSKTPN 482
            .|..|.|.||:|..|  |.|.::|||..|.|||||.:|...:.::.:||.:..|: ....::.|.
Mouse   425 NPEVFDPSRFAPGSS--RHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPI 487

  Fly   483 PLVYDPKSFVLGVKDGIYLKVE 504
            |:   |: .||..|:||:|.::
Mouse   488 PI---PR-IVLKSKNGIHLHLK 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 119/502 (24%)
Cyp4a12aNP_803125.2 p450 52..502 CDD:278495 119/504 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.