DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and erg5

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_593788.2 Gene:erg5 PomBaseID:SPAC19A8.04 Length:543 Species:Schizosaccharomyces pombe

Alignment Length:532 Identity:113/533 (21%)
Similarity:210/533 (39%) Gaps:116/533 (22%)


  Fly     3 LTYILFQVAVALLAILTYYIHRKLTYFKRRG--------IPFVAPHLIRGNMEELQKTKNIHEIF 59
            :.|..:.:..||||:...|  .:::|..::|        |||:...|     :.::.|      |
pombe    24 IEYSKWTICFALLAVCIAY--DQISYQMQKGHIPGPRFKIPFMGSFL-----DSMKPT------F 75

  Fly    60 QDHYNKFRESKAPFVGFFFFQSPAAFVI---DLELAKQILIKDFSNFSNKGIFYN----EKDDPI 117
            :.:..|::......|..|.     .||:   :.:||::||        |...:..    :....|
pombe    76 EKYNAKWQTGPLSCVSVFH-----KFVVIASERDLARKIL--------NSPSYVQPCVVDAGKKI 127

  Fly   118 SAH---LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLV 179
            ..|   :| |||......|..|:..||:..:....|...:|.|::.        |..:...:|..
pombe   128 LKHTNWVF-LDGRDHIEYRKGLNGLFTTRALASYLPAQEAVYNKYF--------KEFLAHSKDDY 183

  Fly   180 ARFTV---DV-IGT-----CAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLAR 235
            |::.:   |: :.|     |.:.|..:::            :.:.|:            |.|:..
pombe   184 AQYMIPFRDINVATSCRTFCGYYISDDAI------------KHIADE------------YWKITA 224

  Fly   236 KLGMVR---TAPHIQEFY---SRIVTETVAVREKEHIKRN------------DFMDMLIELKNQK 282
            .:.:|.   ..|..:.:|   ||.|.....::.....::|            :::..:||.:..|
pombe   225 AMELVNFPIVLPFTKVWYGIQSRKVVMRYFMKAAAESRKNMEAGNAPACMMEEWIHEMIETRKYK 289

  Fly   283 EMTLENGD----VVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEV 343
            ....|..:    ::|..:.||:......|..|..:.:||.|.:....||.:||:..|||.|...:
pombe   290 SENKEGAEKPSVLIREFSDEEISLTFLSFLFASQDATSSAMTWLFQLLADHPDVLQKVREEQLRI 354

  Fly   344 IE-QHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPS 407
            .: ..|...:.:..:.:.|...|:.|.|||...|..:.....|.:  |..|::.:.....||...
pombe   355 RKGDIDVPLSLDLMEKMTYTRAVVKECLRLRPPVLMVPYRVKKAF--PITPDYTVPKDAMVIPTL 417

  Fly   408 SAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRF--GQMQARIGLALLIR 470
            ....||..:||||..|.|:|::|...|.:....|:.||:||..|:|.|:  ..:.|.||.|.::.
pombe   418 YGALHDSKVYPEPETFNPDRWAPNGLAEQSPKNWMVFGNGPHVCLGQRYAVNHLIACIGKASIML 482

  Fly   471 NFKFSTCSKTPN 482
            ::|.   .:||:
pombe   483 DWKH---KRTPD 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 102/489 (21%)
erg5NP_593788.2 CypX 57..505 CDD:225035 105/498 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1742
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.