DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and Cyp3a18

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_665725.1 Gene:Cyp3a18 RGDID:628709 Length:497 Species:Rattus norvegicus

Alignment Length:509 Identity:140/510 (27%)
Similarity:255/510 (50%) Gaps:48/510 (9%)


  Fly     4 TYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRE 68
            |::|...::.|..|...|.|   ..||:.|||...|..:.|.:  ......:.:...|.|.|:  
  Rat    11 TWVLLATSLMLFYIYGTYSH---GLFKKLGIPGPKPVPLFGTI--FNYGDGMWKFDDDCYKKY-- 68

  Fly    69 SKAPFVGFFFFQSPAAFVIDLELAKQILIKD-FSNFSNKGIF----YNEKDDPISAHLFNLDGAQ 128
              ....||:....|...::|.|:.|.:|:|: :|.|:|:..|    :.:|...:|      :..:
  Rat    69 --GKIWGFYEGPQPFLAIMDPEIIKMVLVKECYSVFTNRRCFGPMGFMKKAITMS------EDEE 125

  Fly   129 WRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAFG 193
            |:.||..||.||||||:|.|:|.:....:..:..:..:..|...:.::|:...:::|||...:||
  Rat   126 WKRLRTILSPTFTSGKLKEMFPLMRQYGDTLLKNLRREEAKGEPINMKDIFGAYSMDVITGTSFG 190

  Fly   194 IQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRS---YPKLARKLGMVRTA---PHIQEFYSR 252
            :..:||.:.:..|:...|:.|..:    :.:.|:.|   :|.|.....|:..:   .....|:.:
  Rat   191 VNVDSLNNPQDPFVQKAKKILKFQ----IFDPFLLSVVLFPFLTPIYEMLNFSIFPRQSMNFFKK 251

  Fly   253 IVTETVAVREKEHIKRN--DFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETS 315
            .| :|:.....:..::|  ||:.:::..:|.|....:     :.|:..|:.|||.:|...|::.:
  Rat   252 FV-KTMKKNRLDSNQKNRVDFLQLMMNTQNSKGQESQ-----KALSDLEMAAQAIIFIFGGYDAT 310

  Fly   316 SSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLD 380
            |:::.|.:||||..|::|.|::.|::..: .:....||:...:::||:.|::|:||||.|...||
  Rat   311 STSISFIMYELATRPNVQKKLQNEIDRAL-PNKAPVTYDALMEMEYLDMVVNESLRLYPIATRLD 374

  Fly   381 RMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFG 445
            |::.|...:.|   ..|..|..|.||...:|.:|..:.||.||.|||||.|.........:||||
  Rat   375 RVSKKDVEING---VFIPKGTVVTIPIYPLHRNPEYWLEPEEFNPERFSKENKGSIDPYVYLPFG 436

  Fly   446 DGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPL------VYDPKSFVL 493
            :|||||||:||..:..::.:..:::||....|.||..||      ::.|:..::
  Rat   437 NGPRNCIGMRFALISMKLAVIGVLQNFNIQPCEKTQIPLKISRQPIFQPEGPII 490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 129/475 (27%)
Cyp3a18NP_665725.1 p450 39..493 CDD:278495 130/479 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131170
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.