DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and CYP4Z1

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_835235.1 Gene:CYP4Z1 HGNCID:20583 Length:505 Species:Homo sapiens

Alignment Length:551 Identity:145/552 (26%)
Similarity:224/552 (41%) Gaps:108/552 (20%)


  Fly     3 LTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFR 67
            |..||..:::.|..::..|..|:.........|....|...|: :|....|..     :.|:|..
Human    15 LLLILLCMSLLLFQVIRLYQRRRWMIRALHLFPAPPAHWFYGH-KEFYPVKEF-----EVYHKLM 73

  Fly    68 ES--------KAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISA--H-- 120
            |.        ..||..||....|       :.|| ||:|              :.||.||  |  
Human    74 EKYPCAVPLWVGPFTMFFSVHDP-------DYAK-ILLK--------------RQDPKSAVSHKI 116

  Fly   121 --------LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRD 177
                    |..|||::|:..|..:...|....:|:....:.......:....|.:.:||.||:..
Human   117 LESWVGRGLVTLDGSKWKKHRQIVKPGFNISILKIFITMMSESVRMMLNKWEEHIAQNSRLELFQ 181

  Fly   178 LVARFTVDVIGTCAF----GIQCNSLRDE--KAEFLYFGKRSLVDKRHGTLLNGFMR-------- 228
            .|:..|:|.|..|||    .||.:|..|.  ||.|       .:.|.....:|.|:.        
Human   182 HVSLMTLDSIMKCAFSHQGSIQLDSTLDSYLKAVF-------NLSKISNQRMNNFLHHNDLVFKF 239

  Fly   229 -SYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIK-----------RNDFMDMLIELKNQ 281
             |..::..|..        ||.:.  .||.|....||.:|           |.||:|:|:..|::
Human   240 SSQGQIFSKFN--------QELHQ--FTEKVIQDRKESLKDKLKQDTTQKRRWDFLDILLSAKSE 294

  Fly   282 KEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQ 346
            ........|         :.|:...|..||.:|:||.:.:.||.|||.|:.|.:.|.|:.|::..
Human   295 NTKDFSEAD---------LQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQRCRDEIRELLGD 350

  Fly   347 HDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIH 411
             ..:.|:|....:.|....:.|.||||..|.|:.|:..|....|...:  :.||.:|.|...|:|
Human   351 -GSSITWEHLSQMPYTTMCIKECLRLYAPVVNISRLLDKPITFPDGRS--LPAGITVFINIWALH 412

  Fly   412 HDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFS- 475
            |:|..:.:|..|.|.|||.|.|......|::||..|.|||||..|..::.::.:||.:..||.: 
Human   413 HNPYFWEDPQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQHFAIIECKVAVALTLLRFKLAP 477

  Fly   476 TCSKTPNPLVYDPKSFVLGVKDGIYLKVETV 506
            ..|:.|.|:    :..||..|:||::..:.|
Human   478 DHSRPPQPV----RQVVLKSKNGIHVFAKKV 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 137/511 (27%)
CYP4Z1NP_835235.1 p450 47..500 CDD:278495 138/514 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.