DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp-29A3

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_503130.2 Gene:cyp-29A3 WormBaseID:WBGene00021412 Length:503 Species:Caenorhabditis elegans

Alignment Length:509 Identity:128/510 (25%)
Similarity:225/510 (44%) Gaps:95/510 (19%)


  Fly    12 VALLAILTYY-IHRKLTYFKRRG--IPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRES---- 69
            :.||.|:::: |.:.:..:::..  :|....|.|.||.:.. ..|...||||...:.|.|:    
 Worm    11 ILLLFIVSFWKIMKNILKYRKYDDLLPGPPAHPIFGNTKTF-SNKTTEEIFQALRDLFSEAVEKG 74

  Fly    70 ----KAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPI-SAHLFNLDGAQW 129
                :...:|.|:     .:.:|.:...:||  :.:...:||..|...:|.: ...|....|.:|
 Worm    75 QSLIRHRILGTFY-----VWPLDGKTVSKIL--ESTTELDKGGPYEFFNDWLGGGTLLEGYGERW 132

  Fly   130 RLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAFGI 194
            |..|..|:.||...|::..:....:.:...:..:.:.......:::.....|.|:|.|...|.|.
 Worm   133 RSHRKMLTPTFHFAKLEGYFEVFNTESRVVVDCLDKFAKSGETVDLFPFFKRCTLDTICKTAMGA 197

  Fly   195 QCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKL-----ARKLGMVRTA-PHIQ------ 247
            :                   ||.:       ...|:|.:     |.:||::... ||.|      
 Worm   198 K-------------------VDAQ-------LQNSHPYITAIEQALQLGVLYAMNPHHQIPAIYW 236

  Fly   248 ---------EFYSRIVTET---VAVR---------EKEHIKRN-DFMDMLIELKNQKEMTLENGD 290
                     |:::.:.|.|   :|.|         |||..||| :|:|:|  |.|::...     
 Worm   237 ALGHQKKKDEYFNIMKTFTRNVIAERRTARESGEVEKETSKRNMNFLDIL--LSNEESSV----- 294

  Fly   291 VVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVI-EQHDQNFTYE 354
                |:.|::..:...|..||.:|:::::.:..:.||.:||||..|..|:..|. |..:::.|.|
 Worm   295 ----LSPEDLRQEVDTFMFAGHDTTTTSVSWVCWNLAHHPDIQQNVYEEIVSVFGEDPNEDVTTE 355

  Fly   355 CTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPE 419
            ..|.|:|..::|.|:.|:...||.:.|.......:.|   .:|.||.:|.|...|||.:.:||..
 Worm   356 GIKKLEYTERMLKESKRICPTVPAVLRQLISDMEIGG---VLIPAGANVAIAPMAIHKNANIYQN 417

  Fly   420 PFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFK 473
            |..|.|:||.|||:|.|.:..::||..|.|||||.:|.|:..::.:..|::|||
 Worm   418 PDIFDPDRFLPEETAKRHAYDFIPFSAGLRNCIGQKFAQLNEKVMVIHLLKNFK 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 123/480 (26%)
cyp-29A3NP_503130.2 p450 37..477 CDD:278495 124/484 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.