DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp-31A3

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_500637.2 Gene:cyp-31A3 WormBaseID:WBGene00021200 Length:495 Species:Caenorhabditis elegans

Alignment Length:426 Identity:120/427 (28%)
Similarity:197/427 (46%) Gaps:69/427 (16%)


  Fly    73 FVGFFFFQSPAAFVIDLELAKQILIKDFSNFS--NKGIFYNEKDDPISAHLFNLDGAQWRLLRNK 135
            ::|.|    |...:...:|.:.|    ||:..  |||..|...:..:...:......|||..|..
 Worm    75 WIGPF----PCLMLYSADLVEPI----FSSTKHLNKGFAYVLLEPWLGISILTSQKEQWRPKRKL 131

  Fly   136 LSSTFTSGKMKLMYPTVVSVANEFMTVMHEK---VPKNSVLEIRDLVARFTVDVIGTCAFGIQCN 197
            |:.||....:|...|    :.||...::.:|   :.....:::..::...|:|:|...:.|....
 Worm   132 LTPTFHYDILKDFLP----IFNEQSKILVQKMCSLGAEEEVDVLSVITLCTLDIICETSMGKAIG 192

  Fly   198 SLRDEKAEFLY--FGKRSLVDKRHGTLL--NGFM-------RSYPKLARKLGMVRTAPHIQEFYS 251
            :...|..|:::  .....|:.||....|  |.|:       |::.|..|.|         .:|  
 Worm   193 AQLAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLRIL---------HDF-- 246

  Fly   252 RIVTETVAVREKEHIKRND--------FMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFV-- 306
               |:.|.|..||.::.||        |:|:|:|:             |:...|:|...||.|  
 Worm   247 ---TKKVIVERKEALQENDYKMEGRLAFLDLLLEM-------------VKSGQMDETDVQAEVDT 295

  Fly   307 FFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLR 371
            |...|.:|:|:.:.:|::.|..:|::|.||:||::||:.. |::.|.|....:|||...|.|.||
 Worm   296 FMFEGHDTTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGD-DEDVTIEHLSRMKYLECALKEALR 359

  Fly   372 LYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGR 436
            |:..||.:.|..:...|:.|   ..|..|.:.::....:|.|||.:.:|..|.|:||.||.|..|
 Worm   360 LFPSVPIITRELSDDQVIGG---VNIPKGVTFLLNLYLVHRDPSQWKDPDVFDPDRFLPENSIAR 421

  Fly   437 PSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNF 472
            .|.|::||..|.|||||.||..|:.::.:|.|:|||
 Worm   422 KSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNF 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 120/427 (28%)
cyp-31A3NP_500637.2 p450 36..472 CDD:278495 120/427 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.