DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp-13A7

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_496114.1 Gene:cyp-13A7 WormBaseID:WBGene00000372 Length:518 Species:Caenorhabditis elegans

Alignment Length:549 Identity:142/550 (26%)
Similarity:250/550 (45%) Gaps:96/550 (17%)


  Fly     6 ILFQVAVALLAILTYYIHRKLTYFKR-----RGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYN- 64
            ||..:|: .:.|::||:.....:.::     ||:||:..               ||: |.::.| 
 Worm     5 ILIAIAI-FVGIISYYLWIWSFWIRKGVKGPRGLPFLGV---------------IHK-FTNYENP 52

  Fly    65 ---KFRE---SKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDD------PI 117
               ||.|   ...|..|..........:.|.|...::.:|.|.||..:.:...:.|.      |:
 Worm    53 GALKFSEWTKKYGPVYGITEGVEKTLVISDPEFVHEVFVKQFDNFYGRKLTAIQGDPNKNKRVPL 117

  Fly   118 SAHLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARF 182
            .|    ..|.:|:.||...|.||::..::.:..||.....|.:..:.:...:...|::.:....|
 Worm   118 VA----AQGHRWKRLRTLASPTFSNKSLRKIMGTVEESVTELVRSLEKASAEGKTLDMLEYYQEF 178

  Fly   183 TVDVIGTCAFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNG----FMRS--YP-------KLA 234
            |:|:||..|.|       .||:  |.| :..::||.......|    ||.|  :|       .:.
 Worm   179 TMDIIGKMAMG-------QEKS--LMF-RNPMLDKVKTIFKEGRNNVFMISGIFPFVGIALRNIF 233

  Fly   235 RKLGMVRTAPHIQEFYSRIVTETVAVREKEHI-------KRNDFMDMLIELKN-------QKEMT 285
            .|...::.|..||....:.:.:.:..||.:..       :..||:|:.::.::       :.|..
 Worm   234 AKFPSLQMATDIQSILEKALNKRLEQREADEKAGIEPSGEPQDFIDLFLDARSTVDFFEGEAEQD 298

  Fly   286 LENGDVV---RGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQH 347
            ....:|:   :.||.:|::.|.|||.:||::|::.::.::.|.||.:|:||.|::.||:.  |..
 Worm   299 FAKSEVLKVDKHLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLATHPEIQKKLQEEVDR--ECP 361

  Fly   348 DQNFTYECTKDLKYLNQVLDETLRLY---TIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSA 409
            |...|::....||||..|:.|.||||   ::|.|  |...|...|.|   ..||||.::.:.:.:
 Worm   362 DPEVTFDQLSKLKYLECVVKEALRLYPLASLVHN--RKCLKTTNVLG---MEIEAGTNINVDTWS 421

  Fly   410 IHHDPSIYPEPF-EFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFK 473
            :||||.::.:.. ||:|||:...:........:||||.|||.|||:|...|:.::.|..:::|:.
 Worm   422 LHHDPKVWGDDVNEFKPERWESGDELFFAKGGYLPFGMGPRICIGMRLAMMEMKMLLTNILKNYT 486

  Fly   474 FSTCSKTPNPL------VYDPKSFVLGVK 496
            |.|..:|..||      ...|.|.:|.:|
 Worm   487 FETTPETVIPLKLVGTATIAPSSVLLKLK 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 132/512 (26%)
cyp-13A7NP_496114.1 p450 33..499 CDD:278495 132/503 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97993
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.711 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.