DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp-13A3

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_496110.1 Gene:cyp-13A3 WormBaseID:WBGene00011675 Length:520 Species:Caenorhabditis elegans

Alignment Length:538 Identity:146/539 (27%)
Similarity:239/539 (44%) Gaps:95/539 (18%)


  Fly     1 MALTYILFQVAVAL-LAILTYYIHRKLTYFKR-----RGIPFVAPHLIRGNMEELQKTKNIHEIF 59
            |:|:.:   :|:|| :.:.|||:.....:.::     ||:||.                .|...|
 Worm     1 MSLSIL---IAIALFIGVFTYYLWIWSFWMRKGIKGPRGLPFF----------------GIINAF 46

  Fly    60 QDHYNK--------FRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDP 116
            |. |.|        :.:...|..||.........|.|.|...::.:|.|.|      ||..|.:|
 Worm    47 QS-YEKPWILRLGDWTKEYGPMYGFTDGVEKTLVVSDPEFVHEVFVKQFDN------FYARKQNP 104

  Fly   117 ISA--------HLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVL 173
            :..        ||....|.:|:.||...|.||::..::.::.||.....|.|..:.:.......:
 Worm   105 LQGDPDKDPRIHLVTSQGHRWKRLRTLASPTFSNKSLRKIFSTVEESVAEMMRHLEKGTAGGKTI 169

  Fly   174 EIRDLVARFTVDVIGTCAFGIQCNSLRDEKAEFLYFGK-RSLVDKR-------------HGTLLN 224
            :|.:....||:|:||..|.| |..|:..|..   :..| |::.:.|             .|::..
 Worm   170 DILEYYQEFTMDIIGKIAMG-QSGSMMFENP---WLDKIRAIFNTRGNIIFIICGIVPFTGSIFR 230

  Fly   225 GFMRSYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRN----DFMDMLIELKNQK--- 282
            .|....|...    .|.:..|..|.......|..|..||..|:.:    ||:|:.::::...   
 Worm   231 WFFSKVPTAQ----TVTSLMHTLEIALTKRVEQRAADEKAGIESSGEPQDFIDLFLDVQADTDFL 291

  Fly   283 EMTLENG-------DVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEV 340
            |...:||       .|.:.||.:|::.|.|||.:||::|::.::.::.|.||::|:||.|::.||
 Worm   292 EDETKNGFARSQIVKVDKHLTFDEIIGQLFVFLLAGYDTTALSLSYSSYLLARHPEIQKKLQEEV 356

  Fly   341 EEVIEQHDQNFTYECTKDLKYLNQVLDETLRLY---TIVPNLDRMAAKRYVVPGHPNFVIEAGQS 402
            :.  |..|...|::....|||:..|:.||||||   :||.|  |...|...|.|   ..||.|.:
 Worm   357 DR--ECPDPEVTFDQLSKLKYMECVIKETLRLYPLASIVHN--RKCMKSTTVLG---MKIEEGTN 414

  Fly   403 VIIPSSAIHHDPSIYPE-PFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLA 466
            |...:..:|:||..:.| ..||:|||:...:.......|:||||.|||.|||:|...|:.::.||
 Worm   415 VQADTWTLHYDPKFWGENANEFKPERWESGDEQAVAKGAYLPFGLGPRICIGMRLAYMEEKMLLA 479

  Fly   467 LLIRNFKFSTCSKTPNPL 484
            .:::.:...|..:|..||
 Worm   480 QILKKYSLETTFETHIPL 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 134/495 (27%)
cyp-13A3NP_496110.1 p450 33..512 CDD:278495 138/504 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97993
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.702 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.