DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp-43A1

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_508961.3 Gene:cyp-43A1 WormBaseID:WBGene00017108 Length:526 Species:Caenorhabditis elegans

Alignment Length:530 Identity:134/531 (25%)
Similarity:222/531 (42%) Gaps:125/531 (24%)


  Fly    27 TYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRESKAPFVGFFFFQSPAAFVIDLEL 91
            |:...||   ..|.:|..|::      .||.|..:|::.| .|:.|                   
 Worm    66 TFSVLRG---ATPVVITSNVD------LIHAISTEHFDCF-HSRIP------------------- 101

  Fly    92 AKQILIKDFSNFSNKGIFYNEKDDPISA---HLFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVV 153
              :||                .||||::   |:|...|.:|:.||...|...::.|:||::||:.
 Worm   102 --EIL----------------SDDPITSDNIHMFAAKGERWKRLRTLTSYGLSTVKLKLLFPTMD 148

  Fly   154 SVANEFMTVMHEKVPKNSVL--EIRDLVARFTVDVIGTCAFG----------------------I 194
            :..:|||..::......||:  ....|....|..|:..||:|                      .
 Worm   149 TCVSEFMDHVNSLSDGQSVVINHSHSLFQNHTSYVLARCAYGHKEKNHRVNNFLGVFSKAFGNFA 213

  Fly   195 QCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPH-IQEFYSRIVTET- 257
            :......||..:: |.:..|:.|      |.|:..:.|.|.:...:....| |..|.||...:. 
 Worm   214 ELQKSTAEKIAYI-FPETKLIFK------NSFVGHFLKSATQQKFLDYLLHLISNFQSRKNVDNN 271

  Fly   258 --VAVREKEHIKRNDFM------DMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFET 314
              :...|.:|.....|.      ..||| |.:.::.::...|.:.::.||:.||.....:|||:|
 Worm   272 NGICCTENDHYSLLGFFFEHHNEKKLIE-KAEGQIDMKKVKVEKSISYEEITAQCKFISVAGFDT 335

  Fly   315 SSSTMGFALYELAKNPDIQDKV-RAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPN 378
            :|:|:......||.|||:|||: .||::...||    .::|....|:.|...:.|||||:   |:
 Worm   336 TSNTLTLLFNFLANNPDVQDKIYEAEIKNQPEQ----ISFETVSSLRLLQNCIFETLRLF---PH 393

  Fly   379 LDRMAAKRYVVP---GHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFE-FRPERFSPEESAGRPSV 439
            ...:..:....|   |...| :|..|.|:.|... |||..|:....: |||.||  |....:...
 Worm   394 ASPLQTRICTEPFKIGKYQF-LENVQIVVNPWGP-HHDREIWGNDVDCFRPSRF--ENLTEQQRK 454

  Fly   440 AWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYD--PKSFVLGVKD----- 497
            |::|||.|||.|:|:||..::.:.....:::  |:|..:.:|   |:|  .|:..:.|:|     
 Worm   455 AFMPFGVGPRQCVGMRFALLEMKTTAFRMLQ--KYSVFTNSP---VHDRHGKTVRMTVRDTGTIW 514

  Fly   498 -----GIYLK 502
                 |:.||
 Worm   515 PTDKLGLVLK 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 131/519 (25%)
cyp-43A1NP_508961.3 p450 33..495 CDD:299894 126/500 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24292
Phylome 1 0.910 0.806 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.