DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp-29A2

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_505847.1 Gene:cyp-29A2 WormBaseID:WBGene00011830 Length:503 Species:Caenorhabditis elegans

Alignment Length:514 Identity:123/515 (24%)
Similarity:230/515 (45%) Gaps:79/515 (15%)


  Fly     6 ILFQVAVA-LLAILTYYIHRKLTYFKRR-----GIPFVAPHLIRGNMEEL--QKTKNIHEIFQDH 62
            |...:::| :||.|..:|...|.| ||.     .:|....|.|.||:..:  :||:::..:|.:.
 Worm     3 IFIPISIAIILAYLATWIPTLLKY-KRHWQYGSKLPGPPAHPIFGNLGPIVGKKTEDLPSVFINW 66

  Fly    63 YNKFRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFNLD-- 125
            ..:.|:.....:.........|:.::.:.|..|:  |.:..:|||..|...|..:...|. |:  
 Worm    67 AAEQRDQGHSVMRVMILGKVYAWPLNGKAAAAII--DSTTETNKGDDYRFFDPWLGGGLL-LEGY 128

  Fly   126 GAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTC 190
            |.:|:..|..|:..|...|:...:....:.:...:.::.:.......::|...|.|..:|:|...
 Worm   129 GERWKSHRKMLTPAFHFAKLGGYFEVFNNESKILIDLLSDFSASGETVDIFPYVKRCALDIISET 193

  Fly   191 AFGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLG-MVRTAPHIQEFY---- 250
            |.||:.::..:.             |.::...:.|:        .|:| :|...||::..:    
 Worm   194 AMGIKIDAQINH-------------DHKYVQAVEGY--------NKIGVLVSFNPHLKNQFIFWA 237

  Fly   251 ------------------SRIVTETVAVR-----EKEHIKR-NDFMDMLIELKNQKEMTLENGDV 291
                              .:::.|..|..     |||..|| .:|:|:::.::...:        
 Worm   238 TGYKAQYDDYLSTLKSMTEKVIKERRAAHDSGEVEKETSKRMMNFLDLMLSMEESNQ-------- 294

  Fly   292 VRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVI-EQHDQNFTYEC 355
               ||.|::..:...|..||.:|::|:..:|.:.||.||::|:||..|:.||. :..:.:.|.|.
 Worm   295 ---LTSEDIRQEVDTFMFAGHDTTTSSTSWACWNLAHNPNVQEKVYKEMIEVFGDDPNTDITLEN 356

  Fly   356 TKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEP 420
            ..:|.||:.||.|:.|:...||.|.|.......:.|   :::.||.:|.|....:|.:..::..|
 Worm   357 VNNLNYLDIVLKESKRIIAPVPALQRKLTNDLEIDG---YIVPAGGNVTISPMVLHSNHHVFKNP 418

  Fly   421 FEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSK 479
            .||.|:||.|:|.:.|....::||..|||||||.:|.|:..::.::.::||||.....|
 Worm   419 TEFNPDRFLPDEVSKRHPYDFMPFLAGPRNCIGQKFAQLNEKVMISHIVRNFKIEPTLK 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 112/476 (24%)
cyp-29A2NP_505847.1 p450 37..495 CDD:278495 113/480 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.