DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and cyp-13A10

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_496085.3 Gene:cyp-13A10 WormBaseID:WBGene00014254 Length:519 Species:Caenorhabditis elegans

Alignment Length:530 Identity:138/531 (26%)
Similarity:254/531 (48%) Gaps:80/531 (15%)


  Fly     3 LTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFR 67
            ::.||..:....:..::||:. ..||::|||||....:.:.|:..:..|::      ...|.:.|
 Worm     1 MSVILLAIPTLFIGFISYYLW-IWTYWRRRGIPGPLGYPLVGSFPKTLKSE------YPQYLQIR 58

  Fly    68 E-SK--APFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPIS--------AHL 121
            : :|  .|..|:.........|.|:::.:||.::.:.|      ||..|.:||.        .:|
 Worm    59 DWTKLYGPIYGYTEGTIKTLIVSDIDIVRQIFVEQYDN------FYGRKLNPIQGDPEKDERTNL 117

  Fly   122 FNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDV 186
            |:..|.:|:.||...|.||::..::.:..||...|.|.:..:.|:..:...:::......||:|.
 Worm   118 FSAQGFRWKRLRAISSPTFSNNSLRKINVTVEDSAMELLRHIEEQTSEGQQIDMLQFYQEFTMDT 182

  Fly   187 IGTCAFGIQCNS--LRDEKAEFL--YFGKRSLVDKRHGTLLNGFMRSYPKLAR-------KLGMV 240
            ||..|.| |.:|  .::...:|:  .||.    :::|..|:.|.   :|.||:       |..::
 Worm   183 IGRIAMG-QTDSQMFKNPLLKFVRAIFGD----NRKHIPLIGGV---FPTLAQVFRFFMLKFPLL 239

  Fly   241 RTAPHIQEFYSRIVTETVA------VREKEHIKRN--------DFMDMLIELK--NQKEMTLENG 289
            ..|..|.      |.:||.      :.::|:.::|        ||:|:.:|.:  :.:.....||
 Worm   240 GAANFIH------VNKTVVTAVQNRIDQRENDRKNGIEIGEPQDFIDLFLEARADDVEHFQENNG 298

  Fly   290 DVV-------RGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVE-EVIEQ 346
            |..       |.||.:|::.|..||.||||:|::.::.:..:.||.:|::|.|::.|:| |.|| 
 Worm   299 DFSKTSSYGNRQLTTQEIVGQCLVFLIAGFDTTALSLSYTTFLLATHPEVQKKLQEEIERECIE- 362

  Fly   347 HDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIH 411
              .:.:::....|||::.::.||||||.:....:.....|....|  |..:|.|..|.:.:.::|
 Worm   363 --PSISFDHLSKLKYMDCIIKETLRLYPLGTMANSRRCMRATKLG--NVEVEVGTMVQVDTWSLH 423

  Fly   412 HDPSIY-PEPFEFRPERF-SPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKF 474
            .|..|: .:..||:|||: .|..........::.||.|||.|:|:|...|:.::.||.::|.:.|
 Worm   424 TDTKIWGDDAKEFKPERWLDPNCDQVFQKGGYISFGLGPRQCVGMRLAYMEEKMLLAHILRKYTF 488

  Fly   475 STCSKTPNPL 484
            ...:||..||
 Worm   489 EVGTKTEIPL 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 127/495 (26%)
cyp-13A10NP_496085.3 p450 32..500 CDD:278495 128/499 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T97993
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.702 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.