DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and LOC100910877

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_003751175.1 Gene:LOC100910877 RGDID:6495986 Length:502 Species:Rattus norvegicus

Alignment Length:523 Identity:159/524 (30%)
Similarity:257/524 (49%) Gaps:57/524 (11%)


  Fly     2 ALTYILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKF 66
            |||...:.:...:|.:|..:..|....||::|||...|....|.:  |.....:.:...:.:.|:
  Rat     6 ALTLETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPFFGTV--LNYYMGLWKFDVECHKKY 68

  Fly    67 RESKAPFVGFFFFQSPAAFVIDLELAKQILIKD-FSNFSNK------GIFYN----EKDDPISAH 120
                ....|.|..|.|...:.|.|:.|.:|:|: ||.|:|:      ||...    .||:     
  Rat    69 ----GKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAISVSKDE----- 124

  Fly   121 LFNLDGAQWRLLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVD 185
                   :|:..|..||.|||||::|.|:|.:....:  :.|.:.:..|...:.::::...:::|
  Rat   125 -------EWKRYRALLSPTFTSGRLKEMFPVIEQYGD--ILVKYLRQEKGKPVPVKEVFGAYSMD 180

  Fly   186 VIGTCAFGIQCNSLRDEKAEFLYFGKRSL-VDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQ-- 247
            ||.:.:||:..:||.:.|..|:...|:.| :|......|:..:  :|.|.....|:......:  
  Rat   181 VITSTSFGVNVDSLNNPKDPFVEKAKKLLRIDFFDPLFLSVVL--FPFLTPVYEMLNICMFPKDS 243

  Fly   248 -EFYSRIV---TETVAVREKEHIKRNDFMDMLIELKN---QKEMTLENGDVVRGLTMEEVLAQAF 305
             ||:.:.|   .||.....::|  |.||:.:::...|   .||......|:       |:.||:.
  Rat   244 IEFFKKFVYRMKETRLDSVQKH--RVDFLQLMMNAHNDSKDKESHTALSDM-------EITAQSI 299

  Fly   306 VFFIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETL 370
            :|..||:|.:|||:.|.|:.||.:||.|.|::.|::..:...... ||:...:::||:.||:|||
  Rat   300 IFIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPP-TYDTVMEMEYLDMVLNETL 363

  Fly   371 RLYTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAG 435
            |||.|...|:|:..|...:.|   ..:..|..|:|||.|:|.||..:|||.||||||||.|....
  Rat   364 RLYPIGNRLERVCKKDVEING---VFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERFSKENKGS 425

  Fly   436 RPSVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIY 500
            .....:||||:|||||||:||..|..::.|..:::||.|..|.:|..||....:..:...|. |.
  Rat   426 IDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQGLLQPTKP-II 489

  Fly   501 LKV 503
            |||
  Rat   490 LKV 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 147/485 (30%)
LOC100910877XP_003751175.1 p450 39..492 CDD:278495 148/489 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.