DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a8 and Cyp4a32

Sequence 1:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001093651.1 Gene:Cyp4a32 MGIID:3717148 Length:509 Species:Mus musculus

Alignment Length:523 Identity:134/524 (26%)
Similarity:238/524 (45%) Gaps:63/524 (12%)


  Fly     9 QVA--VALLAILT----YYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQ--DHYNK 65
            |||  :.||.:|.    :|:|||......:..|....|...|: |:.:..:.:.|:..  :|:  
Mouse    20 QVASVLGLLLLLVKAVQFYLHRKWLLKALQQFPSPPFHWFFGH-EQFKGEQELKEVVSCIEHF-- 81

  Fly    66 FRESKAPFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFNLDGAQWR 130
                .:.|..:|:..:....|.|.:..|.||.:  |:....|| |......|...|..|:|..|.
Mouse    82 ----PSAFPCWFWGSNAYLTVYDPDYMKVILGR--SDPKANGI-YRLLAPWIGYGLLLLNGQPWF 139

  Fly   131 LLRNKLSSTFTSGKMKLMYPTVVSVANEFMTVMHEK----VPKNSVLEIRDLVARFTVDVIGTCA 191
            ..|..|:..|   ...::.|.|.::|:. :.:|.:|    ..::|.:||...::..|:|.:..||
Mouse   140 QHRRMLTPAF---HYDILKPYVKNMADS-IRLMLDKWERLAGQDSSIEIFQHISLMTLDTVMKCA 200

  Fly   192 FGIQCNSLRDEKAEFLYFGKRSLVDKRHGTLLNGF--------MRSYPKLAR---KLGMVRTAPH 245
            |..:.:...|...:........|.:..|..:.|.|        :.|..:||:   :|....|...
Mouse   201 FSHKGSVQVDGNYKTYLQAIGDLNNLFHSRVRNIFHQNDTIYRLSSNGRLAKQACQLAHDHTDGV 265

  Fly   246 IQEFYSRIVTETVAVREKEHIK---RNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVF 307
            |:....::..|    .|.|:||   |.||:|:|:..:      :||||   .::.:::.|:...|
Mouse   266 IKMRKDQLQDE----GELENIKKKRRLDFLDILLFAR------MENGD---SMSDKDLRAEVDTF 317

  Fly   308 FIAGFETSSSTMGFALYELAKNPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRL 372
            ...|.:|::|.:.:..|.||.:|:.|.:.|.||:.::.. ..:.|::....:.|....:.|.|||
Mouse   318 MFEGHDTTASGVSWIFYALATHPEHQQRCREEVQSLLGD-GSSITWDHLDQIPYTTMCIKEALRL 381

  Fly   373 YTIVPNLDRMAAKRYVVPGHPNFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRP 437
            |..||.:.|..:.....|...:  :..|..|.:....:||:|.::|.|..|.|.||:|:  :.|.
Mouse   382 YPPVPGIVRELSTSVTFPDGRS--LPKGVQVTLSIYGLHHNPKVWPNPEVFDPSRFAPD--SPRH 442

  Fly   438 SVAWLPFGDGPRNCIGLRFGQMQARIGLALLIRNFK-FSTCSKTPNPLVYDPKSFVLGVKDGIYL 501
            |.::|||..|.|||||.:|...:.::.:||.:.:|: ....::.|.||.    ..||..|:||||
Mouse   443 SHSFLPFSGGARNCIGKQFAMSELKVIVALTLLHFELLPDPTRVPEPLA----RIVLKSKNGIYL 503

  Fly   502 KVE 504
            .::
Mouse   504 HLK 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 123/485 (25%)
Cyp4a32NP_001093651.1 p450 52..503 CDD:278495 123/487 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.