DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a21 and Cyp6d2

Sequence 1:NP_611003.2 Gene:Cyp6a21 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_611698.1 Gene:Cyp6d2 FlyBaseID:FBgn0034756 Length:512 Species:Drosophila melanogaster

Alignment Length:497 Identity:162/498 (33%)
Similarity:262/498 (53%) Gaps:52/498 (10%)


  Fly     5 TVLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGV-RTARSFNEIWTSYYNKFRG 68
            |:|||.|:|.:.|..:|...|  |||.||:..|...|..|.|..| :..||........|  .|.
  Fly     3 TILLTILIAGLLYRYVKRHYT--HWQRLGVDEEPAKIPFGVMDTVMKQERSLGMALADIY--ARH 63

  Fly    69 SGPFAGFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKWRTMRN 133
            .|...|.|...:.::.:.:..||:||:..:|..|.|||.:.:.:.||||..||.|.|..||.:|.
  Fly    64 EGKIVGIYMLNKRSILIRDAQLARQIMTSDFASFHDRGVYVDEDKDPLSANLFNLRGASWRNLRQ 128

  Fly   134 KLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTCAFGIECSSL 198
            ||:.:|:|||:|.||.|:..|.::........:.:|..||:::::..:..|:||:..||:|..|.
  Fly   129 KLTPSFSSGKIKGMFGTIDDVGDKLVQHLEGALDQSDEVEIKDVMTTYAVDIIGSVIFGLEIDSF 193

  Fly   199 KDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLH-MKM-TAEPIERFFMRI--------- 252
            ::|..||||:...:..::              :|..::| |.| ...||.:...|:         
  Fly   194 RNPKNEFREISSSTSRDE--------------SLLLKIHNMSMFICPPIAKLMNRLGYESRILTS 244

  Fly   253 ----VRETVAFREQNNIRRNDFMDQLIDLKNKPLMVSQSGESV-----------NLTIEEIAAQA 302
                ::.|:.|||::|:.|.|.:..||.|:|.. .:.:..:.|           :::||:|||||
  Fly   245 LRDMMKRTIEFREEHNVVRKDMLQLLIRLRNTG-KIGEDDDQVWDMETAQEQLKSMSIEKIAAQA 308

  Fly   303 FVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCN----GELNYESMKDLVYLDQV 363
            |:|:.||.|:::....|.||||:...::....::|...|:.|.|    ....||:::||.:||..
  Fly   309 FLFYVAGSESTAAASAFTLYELSMYPELLKEAQEEVDAVLMKHNLKPKDRFTYEAVQDLKFLDIC 373

  Fly   364 VSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNFSP 428
            :.||:|.|..||.|||||.|||.||| ..::|.||.|:||....|.||...:.|||.::|..|..
  Fly   374 IMETIRKYPGLPFLNRECTEDYPVPG-TNHIIAKGTPILISLFGMQRDPVYFPNPNGYDPHRFDS 437

  Fly   429 ERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDF 470
            ..: ..|...::|||:|||:||.:|.|::.:::.:|.::.:|
  Fly   438 NNM-NYDQAAYMPFGEGPRHCIALRMGKVNSKVAVAKILANF 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 148/468 (32%)
Cyp6d2NP_611698.1 p450 65..506 CDD:278495 139/432 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C51452
eggNOG 1 0.900 E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3274
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.