DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a21 and Cyp6a8

Sequence 1:NP_611003.2 Gene:Cyp6a21 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:497 Identity:277/498 (56%)
Similarity:367/498 (74%) Gaps:5/498 (1%)


  Fly    10 ALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKFRGS-GPFA 73
            ||||::.|.:.:   .:.:::..|||...||::.|:|:.::..::.:||:..:|||||.| .||.
  Fly    13 ALLAILTYYIHR---KLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRESKAPFV 74

  Fly    74 GFYWFRRPAVFVLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQLFLLDGQKWRTMRNKLSST 138
            ||::|:.||.||::..||||||||:|:.|:::|.|:|.:|||:|..||.|||.:||.:|||||||
  Fly    75 GFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFNLDGAQWRLLRNKLSST 139

  Fly   139 FTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVIGTCAFGIECSSLKDPDA 203
            |||||||.|:||||.|||||..|..:.|.|:.|:|:|:|:||||.||||||||||:|:||:|..|
  Fly   140 FTSGKMKLMYPTVVSVANEFMTVMHEKVPKNSVLEIRDLVARFTVDVIGTCAFGIQCNSLRDEKA 204

  Fly   204 EFREMGRRSLTEQRLGPVGIGFVNSFPNLARRLHMKMTAEPIERFFMRIVRETVAFREQNNIRRN 268
            ||...|:|||.::|.|.:..||:.|:|.|||:|.|..||..|:.|:.|||.||||.||:.:|:||
  Fly   205 EFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREKEHIKRN 269

  Fly   269 DFMDQLIDLKNKPLMVSQSGESV-NLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQN 332
            ||||.||:|||:..|..::|:.| .||:||:.|||||||.|||||||:||||||||||:|.|||:
  Fly   270 DFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAKNPDIQD 334

  Fly   333 RVRKECQEVIEKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKK 397
            :||.|.:||||:.:....||..|||.||:||:.|||||||::|.|:|...:.|.|||||.:||:.
  Fly   335 KVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHPNFVIEA 399

  Fly   398 GMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIG 462
            |..|:||..|:|.|..:|..|..|.|:.||||....|.||.|||||||||||||:||||||||||
  Fly   400 GQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQMQARIG 464

  Fly   463 LALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGIYLKAERV 504
            |||||::||||.|.||..|:.|:.:.|::....|||||.|.|
  Fly   465 LALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVETV 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 266/466 (57%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 267/464 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5001730
eggNOG 1 0.900 E2759_KOG0158
Homologene 1 1.000 H130979
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.