DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a19 and CYP721A1

Sequence 1:NP_611001.2 Gene:Cyp6a19 FlyBaseID:FBgn0033979 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_177649.1 Gene:CYP721A1 AraportID:AT1G75130 Length:505 Species:Arabidopsis thaliana

Alignment Length:574 Identity:137/575 (24%)
Similarity:236/575 (41%) Gaps:145/575 (25%)


  Fly     1 MAILLGLVVGVLTLV-------AW--WVLQNYTYWKRRGIPHDPPNIPLGNTGELWR------TM 50
            ||:...||:....||       .|  |.:|  :::|::.:......|..||:||:.|      :.
plant     1 MAVFFILVLVFFFLVFRFIYSNIWVPWRIQ--SHFKKQSVTGPSYRIFSGNSGEVSRLTAEAKSK 63

  Fly    51 PL--------------------AGILKRTYLKFRKQTDGPFAGFYLYAMKYIVIT-DVDFVKTVL 94
            |:                    :.:..:|:|             |.:..|.:|.| |...::..|
plant    64 PIPSGRNPHEFVHRVAPHYHEWSRVYGKTFL-------------YWFGSKPVVATSDPRLIREAL 115

  Fly    95 IR--DFDKFHDRGVYHNEKDDPLT-----NNLATIEGQKWKNLRQKLTHTFTSAKMK-----SMF 147
            ..  .||:     :.||    ||:     ..|..:.|.:|...|:.....||..|:|     .:.
plant   116 TTGGSFDR-----IGHN----PLSKLLYAQGLPGLRGDQWAFHRRIAKQAFTMEKLKRWVPQMVT 171

  Fly   148 STVL---------NVGDEMIRVVDEKISSSSQTLEVTDIVSRFTSDVIGICAFGLKCNSLRDPKA 203
            ||::         |.|:|:             .|||...:...:::::...|||   ||:.:.| 
plant   172 STMMLMEKWEDMRNGGEEI-------------ELEVHKEMHNLSAEMLSRTAFG---NSVEEGK- 219

  Fly   204 EFVQMGYSALRERRHGWLVDLLIFGMPKLAVKL-GFQFLLPS------------VQKFYMKIVQD 255
                 |...|:||.      :.:|.:.:.:|.: ||:| .||            ::...:|::::
plant   220 -----GIFELQERM------MRLFYLVRWSVYIPGFRF-FPSKTNREIWRIEKQIRVSILKLIEN 272

  Fly   256 TIDYRMKRKVTRNDFMDTLID--MKQQYDKGDKENGLAFNEVAAQAFVFFLAGFEAGSTTMGFTL 318
            .     |..|.::   .||:.  |....::..:|..|...||..:...|:.|..|..:..|.|.|
plant   273 N-----KTAVEKS---GTLLQAFMSPYTNQNGQEEKLGIEEVTDECKTFYFAAKETTANLMTFVL 329

  Fly   319 YELACNQDVQDKLRAEIDSVLERYNGKLEYDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQ 383
            ..||.||:.|:..|.|:..||.: .|....|.:|||..:..:|||:||.:|....|.|...|..:
plant   330 VLLAMNQEWQNIAREEVICVLGQ-TGLPTLDILQDLKTLSMIINETLRLYPPAMTLNRDTLKRAK 393

  Fly   384 HSNPKYFIEAGTGVLVSTLGIHHDPEFY-PEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCIG 447
            ..:  ..|.|||.:.:|.:.:|||.|.: .:.|:|.|.||::   .|:.:...:|||.|||.|:|
plant   394 LGD--LDIPAGTQLYLSVVAMHHDKETWGDDAEEFNPRRFED---PKKQSALLVPFGLGPRTCVG 453

  Fly   448 LRFGRMQVIIGLALLIHNFRFELHPK-TPVPMKYTINNLLLGSEGGIHLNITKV 500
            ......:....||.::..:.|.|.|. ...|:.:    :.|..:.|.||..|::
plant   454 QNLAVNEAKTVLATILKYYSFRLSPSYAHAPVLF----VTLQPQNGAHLLFTRI 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a19NP_611001.2 p450 32..495 CDD:278495 125/528 (24%)
CYP721A1NP_177649.1 p450 26..495 CDD:299894 126/540 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.