DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and CYP86A4

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_171666.1 Gene:CYP86A4 AraportID:AT1G01600 Length:554 Species:Arabidopsis thaliana

Alignment Length:556 Identity:117/557 (21%)
Similarity:218/557 (39%) Gaps:117/557 (21%)


  Fly    10 LLVSLLLFMARRRHGYWQ-----RRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKRSVYP 69
            |||:::.       |||.     .|.:......|:.|::....::|.   ...::.|:..|:.  
plant     8 LLVAIVT-------GYWLWFKRISRWLKGPRVWPLLGSLPGLIEQRD---RMHEWITENLRAC-- 60

  Fly    70 FAGFY--------FFFTRSAVIT---DLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEG 123
             .|.|        |...:..::|   |.:.::.:|...|:::.....:.:...|.|...:|:.:|
plant    61 -GGTYQTCIFAVPFLAKKQGLVTVTCDPKNLEHMLKTRFDNYPKGPTWQSVFHDLLGQGIFNSDG 124

  Fly   124 QKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGN 188
            ..|...|......||:..::......|..|.::.......|.....:.:::.||:.|.|.|.|..
plant   125 DTWLFQRKTAALEFTTRTLRQAMGRWVNRGIKLRFCPILATAQDNAEPVDLQDLILRLTFDNICG 189

  Fly   189 CAFGLNCNSLQN--PNAEFVTIGKRAIIERRYGGLLDFLIFGFP-KLSRRLRLKLNVQ------D 244
            .|||.:..:...  |...|.:...||    ....|..|:|..|. ||.:.|.|.|.|.      :
plant   190 LAFGKDTRTCAPGLPENGFASAFDRA----TEASLQRFIIPKFMWKLKKWLGLGLEVSLSRSLGE 250

  Fly   245 VEDFYTSIVRNTIDYRLRTNE-----KRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQ--AFIF 302
            ::::..::: ||....|.:.:     :|||.:.|...|.:.|         |:::...|  |..|
plant   251 IDEYLAAVI-NTRKQELMSQQESGTHQRHDDLLSRFMMKKTE---------SYSDTFLQHVALNF 305

  Fly   303 FVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVL----------SKHNNEFTYEGIKEMKYL 357
            .:||.:|||..:.:..:.:.:...::|::..||.:||          |.......::.|..:.||
plant   306 ILAGRDTSSVALSWFFWLITMHPTVEDKIVREICSVLIETRGTDDVASWTEEPLGFDEIDRLVYL 370

  Fly   358 EQVVMETLRKYPVLAHLTRMTQTDFSPEDPKY-----------FIAKGTTVV--IPALG------ 403
            :..:.||||.||.:            |||.|:           |:..|::|.  |.|.|      
plant   371 KAAISETLRLYPSV------------PEDSKHVENDDVLPDGTFVPAGSSVTYSIYAAGRMKSTW 423

  Fly   404 ----IHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQ-ACVGLAYLI 463
                :.::||.:..|        .|..........::.|..|||.|:|.....:| ..:..|.|:
plant   424 GEDCLEFNPERWISP--------IDGKFINHDQYRFVAFNAGPRICLGKDLAYLQMKTIAAAVLL 480

  Fly   464 RGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEK 499
            | ::.:|....::..|.   |:.|..:||:.:.:.|
plant   481 R-HRLTVVPGHKVEQKM---SLTLFMKNGLLVNLYK 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 109/520 (21%)
CYP86A4NP_171666.1 PLN03195 5..513 CDD:215627 117/557 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1247045at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
32.930

Return to query results.
Submit another query.