DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and CYP96A2

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_194944.1 Gene:CYP96A2 AraportID:AT4G32170 Length:506 Species:Arabidopsis thaliana

Alignment Length:543 Identity:117/544 (22%)
Similarity:220/544 (40%) Gaps:88/544 (16%)


  Fly     1 MSLLLTLIALLVSLLL--FMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKY 63
            :|||...:|:|..|:|  |:.::.||.:.|                :||..|.:..:.:..:..|
plant     4 ISLLQVSVAILCFLILHYFLFKKPHGRYPR----------------NWPVLRMLPAMLKALHRIY 52

  Fly    64 KRSV---------YPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLF 119
            ..||         :||.|..|......:..|...:..::..:|::: .:|..:.::.|.|..:..
plant    53 DYSVKILETSDLTFPFKGPRFTGMDMLLTVDPANIHHIMSSNFSNY-IKGPEFQDVFDVLGDSFI 116

  Fly   120 SIEGQKWRHLRHKL-------------TPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQV 171
            :.:.:.|:::|...             ..|.||.....:.|::....|             ||..
plant   117 TTDSELWKNMRKSYQAMLHSQEFQRFSMSTMTSKLKYGLVPLLNHFAE-------------EGTT 168

  Fly   172 LEIVDLVARYTADVIGNCAFGLNCNSL--QNPNAEFV----TIGKRAIIERRY-----GGLLDFL 225
            |::..:..|:|.|.|.....|.:..||  :.|..||.    .:|: .|:.|.:     ..|.:::
plant   169 LDLQSVFGRFTFDTIFILVTGSDPRSLSIEMPEDEFAKALDDVGE-GILYRHFKPRFLWKLQNWI 232

  Fly   226 IFGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLRT-NEKRHDFMDSLIEM--YEKEQAGNTE 287
            .||..|  :..........|...|.|..|..|.....| |....|.:.|.|::  .:.:....::
plant   233 GFGQEK--KLTEANATFDRVCAKYISAKREEIKRSQGTSNGGSQDLLTSFIKLDTTKYKLLNPSD 295

  Fly   288 DGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAE--INNVLSKHNNEFTYEG 350
            |....:.|||    |.:||.:|::|.:.:..:.|:.:..:..::..|  ||..||:..|  :.|.
plant   296 DKFLRDNILA----FILAGRDTTATALSWFFWLLSENPHVVAKIHQEININTDLSRTGN--SQEN 354

  Fly   351 IKEMKYLEQVVMETLRKYPVLAHLTRM-TQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPE- 413
            :.::.||...:.|.:|.||.::...:. .::|..|...|  :...:.::|....:.....::.| 
plant   355 VDKLVYLHGALCEAMRLYPPVSFGRKSPIKSDVLPSGHK--VDANSKIIICLYALGRMRAVWGED 417

  Fly   414 PEKFKPERFTDE--AIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQI 476
            ..:|||||:..|  .|...||..:|.|..|||.|:|....:.|..:....::|.|...|....:|
plant   418 ASQFKPERWISENGGIKHEPSFKFLSFNAGPRTCLGKHLAMTQMKIVAVEILRNYDIKVLQGQKI 482

  Fly   477 PMKFVVKSILLSAENGIHLKVEK 499
               ......:||.::|:.:.|.|
plant   483 ---VPALGFILSMKHGLQITVTK 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 104/501 (21%)
CYP96A2NP_194944.1 p450 1..503 CDD:299894 117/544 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
21.920

Return to query results.
Submit another query.