DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and CYP72A11

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_188083.1 Gene:CYP72A11 AraportID:AT3G14650 Length:512 Species:Arabidopsis thaliana

Alignment Length:489 Identity:127/490 (26%)
Similarity:217/490 (44%) Gaps:66/490 (13%)


  Fly    17 FMARRRHGYWQRRGIPHDVPHPIYGNMKD----WPKKRHIAMIFRDYYT----KYKRSVYPFAGF 73
            |..:....|.:|:|:......|:.|::|.    ..:.|...:...|..|    .|...:....|.
plant    30 FKPKMLESYLRRQGLAGTPYTPLVGDLKKNFSMRAEARSKPINLTDDITPRIVPYPLQMLKTHGR 94

  Fly    74 YFFFTRSAV----ITDLELVKRVLIKDFNHFENRGIFYNEIDDPLS---AT-LFSIEGQKWRHLR 130
            .||....|:    |.|.|.:..||.|.:: |:....|      ||.   || :.|.:|.||...|
plant    95 TFFTWFGAIPTITIMDPEQITEVLNKVYD-FQKAHTF------PLGRLIATGVLSYDGDKWAKHR 152

  Fly   131 HKLTPTFTSGKMKNMFPIIVKVGEEM----EKIFSAKTTTGEGQVLEIVDL---VARYTADVIGN 188
            ..:.|.|...|:|||.|...:...|:    :|:.|.|.::.|      ||:   :...|||||..
plant   153 RIINPAFHLEKIKNMVPAFHQSCSEIVCKWDKLVSDKESSCE------VDVWPGLVSMTADVISR 211

  Fly   189 CAFGLNC------NSLQNPNAEFV--TIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDV 245
            .|||.:|      ..||...|:.:  |:.|..|....|          .|....| |:|...:::
plant   212 TAFGSSCVEGQRIFELQAELAQLIIQTVRKAFIPGYSY----------LPTKGNR-RMKAKAREI 265

  Fly   246 EDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTE-DGLSFNEILAQAFIFFVAGFET 309
            :    .|:|..::.|||..|......|.|:.:..:...|.|: :|:|..:::.:..:|:..|.||
plant   266 Q----VILRGIVNKRLRAREAGEAPNDDLLGILLESNLGQTKGNGMSTEDLMEECKLFYFVGQET 326

  Fly   310 SSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHL 374
            :|..:.:.:..|:..||.|.:.|.|:..|..  :.|...||:.::|.:..::.|.||.||.:..|
plant   327 TSVLLVWTMVLLSQHQDWQARAREEVKQVFG--DKEPDAEGLNQLKVMTMILYEVLRLYPPIPQL 389

  Fly   375 TRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIY-PEPEKFKPERFTDE-AIAARPSCTWLP 437
            :|....:....|  ..:..|..:.:|.|.:..|.|:: .:..:|||:||.|. :.|.:...::.|
plant   390 SRAIHKEMELGD--LTLPGGVLINLPILLVQRDTELWGNDAGEFKPDRFKDGLSKATKNQASFFP 452

  Fly   438 FGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVS 471
            |..|.|.|||..|.|::|.:.:|.:::.:.|.:|
plant   453 FAWGSRICIGQNFALLEAKMAMALILQRFSFELS 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 123/471 (26%)
CYP72A11NP_188083.1 p450 24..512 CDD:299894 127/490 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.