DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and CYP72A10

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_188082.2 Gene:CYP72A10 AraportID:AT3G14640 Length:536 Species:Arabidopsis thaliana

Alignment Length:522 Identity:128/523 (24%)
Similarity:230/523 (44%) Gaps:75/523 (14%)


  Fly    17 FMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKRS--------VYPFA-- 71
            |..:....|.:|:|:......|:.|::     ||::.|:........|.:        .:||.  
plant    52 FKPKMLESYLRRQGLAGTPYTPLIGDL-----KRNVNMLTEATSKPIKLTEDITPRVLPHPFQML 111

  Fly    72 ---GFYFFF----TRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHL 129
               |..||.    ..:..|.|.||:|.|..|.:::.:.:......:   ::..:.:.:|.||...
plant   112 KTHGRTFFTWLGPKPTITIMDPELIKEVFNKVYDYPKAQTFLLGRL---IATGIINYDGDKWAKH 173

  Fly   130 RHKLTPTFTSGKMKNMFPIIVK-----VGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNC 189
            |..:.|.|...|:|||.|...:     |||..:.:....:::.|   :::...:...|.|||...
plant   174 RRIINPAFHIEKIKNMVPAFHQSCSDVVGEWSKLVSDKGSSSCE---VDVWPWLVSMTGDVISRT 235

  Fly   190 AFGLNCNSLQ---NPNAEFVTIGKRA-----IIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVE 246
            |||.:....|   ...||.|.:..:|     |...||          .|..|.| |:|...::::
plant   236 AFGSSYKEGQRIFELQAELVHLILQAFWKVYIPGYRY----------LPTKSNR-RMKAAAREIQ 289

  Fly   247 DFYTSIVRNTIDYRLRTNE-----KRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAG 306
                .|::..::.|||..|     ...|.:..|:|....:..||   |:|..:::.:..:|:.||
plant   290 ----VILKGIVNKRLRAREAGKAAPNDDLLGILLESNLGQAKGN---GMSTEDVMEECKLFYFAG 347

  Fly   307 FETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVL 371
            .||:|..:.:|:..|:..||.|.:.|.|:..|..  :.|...|.:.::|.:..::.|.||.||.:
plant   348 QETTSVLLVWAMVLLSHHQDWQARAREEVKQVFG--DKEPDTECLSQLKVMTMILYEVLRLYPPV 410

  Fly   372 AHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIY-PEPEKFKPERFTDE-AIAARPSCT 434
            .||||....:....|  ..:..|..:.:|.:.:..||.:: .:..:||||||.|. :.|.:...:
plant   411 THLTRAIDKEMKLGD--LTLPAGVHISLPIMLVQRDPMLWGTDAAEFKPERFKDGLSKATKSQVS 473

  Fly   435 WLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVS-TETQIPMKFVVKSILLSAENGIHLKVE 498
            :.||..|||.|||..|.:::|.:.:|.:::.:.|.:| :....|...|.    :..:.|.||.:.
plant   474 FFPFAWGPRICIGQNFAMLEAKMAMALILQTFTFELSPSYVHAPQTVVT----IHPQFGAHLILR 534

  Fly   499 KL 500
            ||
plant   535 KL 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 121/497 (24%)
CYP72A10NP_188082.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.