DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and cyp3a65

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001032515.1 Gene:cyp3a65 ZFINID:ZDB-GENE-050604-1 Length:517 Species:Danio rerio

Alignment Length:515 Identity:167/516 (32%)
Similarity:262/516 (51%) Gaps:35/516 (7%)


  Fly     6 TLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKRSVYPF 70
            ||:|.|.:||:......|.|:::.|||.....|.:|.|..:....|:  ...|.:.||.|    .
Zfish     9 TLLAFLAALLVIYGSWPHRYFKKLGIPGPKAIPFFGTMLRYKDGFHV--FDMDCFEKYGR----I 67

  Fly    71 AGFYFFFTRSAVITDLELVKRVLIKD-FNHFENRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLT 134
            .|.|........|.|..::|.||||: ::.|.||..|  .::..|...:...|...||.:|..|:
Zfish    68 WGIYDGRQPVLCIMDQTIIKTVLIKECYSLFTNRRNF--RLNGALYDAVSIAEDDDWRRIRSVLS 130

  Fly   135 PTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQ 199
            |:||||::|.||.|:.|....:  :.|...|...|:..:|.:....|:.||:.:.||.::.:||.
Zfish   131 PSFTSGRLKEMFGIMKKHSHIL--VDSMGKTAKRGESADIKEFFGAYSMDVVTSTAFSVDIDSLN 193

  Fly   200 NPNAEFVTIGKRAIIERRYGGL--LDFLIFGFPKLS---RRLRLKLNVQDVEDFYTSIV------ 253
            ||...|||..|:.:   ::..|  |..||..||.::   .::...|....|.||:.:.:      
Zfish   194 NPKDPFVTNIKKML---KFDLLNPLFLLIAFFPFMAPVLEKMDFALFPTSVTDFFYAALQKIKSD 255

  Fly   254 RNTIDYRLRTNEKRHDFM----DSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFETSSTTM 314
            |:|........:||.||:    ||...:..|....:||.|||.:|||:|:.||..||:||||:|:
Zfish   256 RDTKTVAKDNTKKRVDFLQLMVDSQTGVKHKSDGEHTEKGLSDHEILSQSMIFIFAGYETSSSTL 320

  Fly   315 GFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQ 379
            .|..|.||.:.:...:|:.||:... .:.....||.:..|.||:..:.|:||.:||.|.|.|:.:
Zfish   321 SFLFYNLATNPETMKKLQEEIDETF-PNQAPVDYETLMSMDYLDAALSESLRLFPVAARLERVCK 384

  Fly   380 TDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRN 444
            .  :.|.....|.|...|::|...:|.||:.:.|||.|||||||.....:.....::|||.||||
Zfish   385 K--TVEINGLLIPKDLVVMVPTYALHRDPDYWSEPESFKPERFTKGNKESIDPYMYMPFGLGPRN 447

  Fly   445 CIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVE--KLSK 502
            |||:||..:...:.:..:::.:..||..|||:|::..... |||.::.|.||::  |||:
Zfish   448 CIGMRFAQVTMKLAIVEILQRFDVSVCDETQVPLELGFNG-LLSPKDPIKLKLQPRKLSQ 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 151/475 (32%)
cyp3a65NP_001032515.1 p450 35..499 CDD:278495 154/481 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.