DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and cyp3c3

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001007401.2 Gene:cyp3c3 ZFINID:ZDB-GENE-041114-102 Length:503 Species:Danio rerio

Alignment Length:506 Identity:147/507 (29%)
Similarity:265/507 (52%) Gaps:58/507 (11%)


  Fly     1 MSLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKR 65
            :|:..||:.|:::||.......||::::.|||...|.|.:|....              |||   
Zfish     7 LSVTWTLVFLVITLLYMYGVWPHGFFKKLGIPGPRPWPFFGTFLS--------------YTK--- 54

  Fly    66 SVYPFAGFYFFFTRSA-----------------VITDLELVKRVLIKD-FNHFENRGIFYNEIDD 112
                  ||:.|....|                 ::||||::|.:::|: ::.|.||.....::..
Zfish    55 ------GFFNFDMECAKKYGKVWGIYDGRLPILMVTDLEMIKTIMVKECYSTFTNRREVNVDLAG 113

  Fly   113 PLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDL 177
            ||:..:.:::.::|:.:|..|:|.||||::|.:|||.:...:...|....:   ...|.::|.::
Zfish   114 PLADGISAVKDERWKRIRGTLSPYFTSGRLKEIFPIAMTHADRFIKNMQKR---DHEQPVKIKEV 175

  Fly   178 VARYTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRL-RLKLN 241
            ||.|:.||:.:.:|.::.:|:.||:..|||..|..:....:..|:.||.. ||.::..| ::.::
Zfish   176 VAPYSLDVVTSSSFSVDIDSINNPDDPFVTNIKNFLKFSLFSPLILFLTL-FPSIANLLGKMGIS 239

  Fly   242 V--QDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIE-MYEKEQAGNTED-----GLSFNEILAQ 298
            |  :.:.:|:.:.:|...|....:| .|.||:..:|: ....:||.:|..     ||:.:|||:|
Zfish   240 VFSRSIMNFFYTALRKIKDEHKDSN-GRVDFLRLMIQNQIPDDQAKDTTSEQPVKGLTDHEILSQ 303

  Fly   299 AFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVME 363
            :|||.:.|:||:|||:.|.|:.||.:.|..::|..||:..... :...:|:.:.:|.|||..:.|
Zfish   304 SFIFILGGYETTSTTLSFLLHNLATNPDCLEKLVEEIDKNFPL-DTPISYDALMKMDYLEMSINE 367

  Fly   364 TLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIA 428
            ::|..|....|.|:.:.  :.|.....|.|.|.|.||...::.||:::..|::|:||||:.|..:
Zfish   368 SMRLLPTAPRLERVCKK--TVELNGITIPKDTLVAIPTYVLNRDPQLWDSPQEFRPERFSPENKS 430

  Fly   429 ARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMK 479
            ......::|||.|||||||:||.||...:.:..|::.:......|||||::
Zfish   431 EFLQYAFMPFGLGPRNCIGMRFALMIVKLLVVKLLQNFSLETCKETQIPLE 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 136/472 (29%)
cyp3c3NP_001007401.2 p450 38..496 CDD:278495 137/476 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3274
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128662
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.909 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.