DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and Cyp6a8

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_523749.2 Gene:Cyp6a8 FlyBaseID:FBgn0013772 Length:506 Species:Drosophila melanogaster

Alignment Length:501 Identity:249/502 (50%)
Similarity:354/502 (71%) Gaps:7/502 (1%)


  Fly     3 LLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKRSV 67
            :|..:...|:::|.:...|:..|::|||||...||.|.|||::..|.::|..||:|:|.|::.|.
  Fly     6 ILFQVAVALLAILTYYIHRKLTYFKRRGIPFVAPHLIRGNMEELQKTKNIHEIFQDHYNKFRESK 70

  Fly    68 YPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHLRHK 132
            .||.||:||.:.:|.:.||||.|::|||||::|.|:||||||.|||:||.||:::|.:||.||:|
  Fly    71 APFVGFFFFQSPAAFVIDLELAKQILIKDFSNFSNKGIFYNEKDDPISAHLFNLDGAQWRLLRNK 135

  Fly   133 LTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNS 197
            |:.||||||||.|:|.:|.|..|...:...|..  :..||||.|||||:|.||||.||||:.|||
  Fly   136 LSSTFTSGKMKLMYPTVVSVANEFMTVMHEKVP--KNSVLEIRDLVARFTVDVIGTCAFGIQCNS 198

  Fly   198 LQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLR 262
            |::..|||:..|||:::::|:|.||:..:..:|||:|:|.:......:::||:.||..|:..|.:
  Fly   199 LRDEKAEFLYFGKRSLVDKRHGTLLNGFMRSYPKLARKLGMVRTAPHIQEFYSRIVTETVAVREK 263

  Fly   263 TNEKRHDFMDSLIEMYEKEQA----GNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELAL 323
            .:.||:||||.|||:..:::.    |:...||:..|:|||||:||:|||||||:||||||||||.
  Fly   264 EHIKRNDFMDMLIELKNQKEMTLENGDVVRGLTMEEVLAQAFVFFIAGFETSSSTMGFALYELAK 328

  Fly   324 DQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDF-SPEDP 387
            :.||||::|||:..|:.:|:..||||..|::|||.||:.||||.|.::.:|.||....: .|..|
  Fly   329 NPDIQDKVRAEVEEVIEQHDQNFTYECTKDLKYLNQVLDETLRLYTIVPNLDRMAAKRYVVPGHP 393

  Fly   388 KYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGL 452
            .:.|..|.:|:||:..||:||.|||||.:|:||||:.|..|.|||..|||||:|||||||||||.
  Fly   394 NFVIEAGQSVIIPSSAIHHDPSIYPEPFEFRPERFSPEESAGRPSVAWLPFGDGPRNCIGLRFGQ 458

  Fly   453 MQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVE 498
            |||.:|||.|||.:|||..::|..|:.:..||.:|..::||:||||
  Fly   459 MQARIGLALLIRNFKFSTCSKTPNPLVYDPKSFVLGVKDGIYLKVE 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 235/464 (51%)
Cyp6a8NP_523749.2 p450 39..503 CDD:278495 237/466 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5001865
eggNOG 1 0.900 E2759_KOG0158
Homologene 1 1.000 H130979
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.