DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and Cyp6a20

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_611002.3 Gene:Cyp6a20 FlyBaseID:FBgn0033980 Length:501 Species:Drosophila melanogaster

Alignment Length:502 Identity:274/503 (54%)
Similarity:370/503 (74%) Gaps:6/503 (1%)


  Fly     4 LLTLIALLVSLLLFMA---RRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYK- 64
            :..:|.||:.::.|:|   .:...||:|||||||.|...|||..:..|..|.|.||:..|.|.: 
  Fly     1 MAVMIVLLIGVITFVAWYVHQHFNYWKRRGIPHDEPKIPYGNTSELMKTVHFADIFKRTYNKLRN 65

  Fly    65 RSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHL 129
            ::..||.|||.:|.|..|:||::..|.|||::|:.|.:||:|:||.||||||.|.:|:||||:.|
  Fly    66 KTDGPFVGFYMYFKRMVVVTDIDFAKTVLIREFDKFHDRGVFHNERDDPLSANLVNIDGQKWKTL 130

  Fly   130 RHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLN 194
            |.||||||||||||.|||.|:.||:|:.::| .:|.:.:...:||.::|||:||||||:|||||:
  Fly   131 RQKLTPTFTSGKMKTMFPTILTVGDELIRVF-GETASADSDSMEITNVVARFTADVIGSCAFGLD 194

  Fly   195 CNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDY 259
            |:||.:|.|:||.:|..||.|||:|..:|.|:||.|:|:.:||:|..||:|||||.:|:|:|:||
  Fly   195 CHSLSDPKAKFVQMGTTAITERRHGKSMDLLLFGAPELAAKLRMKATVQEVEDFYMNIIRDTVDY 259

  Fly   260 RLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALD 324
            |::.|.|||||:|.||||..|...|:.|:||:||||.|||||||:||||||||||||||||||..
  Fly   260 RVKNNVKRHDFVDMLIEMKLKFDNGDKENGLTFNEIAAQAFIFFLAGFETSSTTMGFALYELACH 324

  Fly   325 QDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKY 389
            |||||:||.|||.||.:||.:..|:.::||.|||:|:.||:||.||:.||.|:....:...:|||
  Fly   325 QDIQDKLRTEINTVLKQHNGKLDYDSMREMTYLEKVIDETMRKRPVVGHLIRVATQHYQHTNPKY 389

  Fly   390 FIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQ 454
            .|.|||.|::|.|.||:|||.|||||||.||||.::.:..||:||:||||:|||||||||||.||
  Fly   390 NIEKGTGVIVPTLAIHHDPEFYPEPEKFIPERFDEDQVQQRPACTFLPFGDGPRNCIGLRFGRMQ 454

  Fly   455 ACVGLAYLIRGYKFSV-STETQIPMKFVVKSILLSAENGIHLKVEKL 500
            ..||:|.||..:||.. .|:|.:|:::.....|||::.||||||.::
  Fly   455 VIVGMALLIHNFKFEFHPTKTVVPLEYRTDDFLLSSKGGIHLKVTRV 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 257/461 (56%)
Cyp6a20NP_611002.3 p450 32..496 CDD:278495 260/465 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0158
Homologene 1 1.000 H130979
Inparanoid 1 1.050 161 1.000 Inparanoid score I1576
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264519at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24292
RoundUp 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.