DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and Cyp4e3

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_523527.1 Gene:Cyp4e3 FlyBaseID:FBgn0015035 Length:526 Species:Drosophila melanogaster

Alignment Length:558 Identity:129/559 (23%)
Similarity:247/559 (44%) Gaps:96/559 (17%)


  Fly     1 MSLLLTLIALLVSLLLFMARRRHGYWQRRGIPHD----VPHPIYGNMKDWPKK-RHIAMIFRDYY 60
            :::|..|:..|::|:.|..:..    |||.:..:    .|.||.||.....|. ..|...|.|::
  Fly     3 LAVLALLVLPLITLVYFERKAS----QRRQLLKEFNGPTPVPILGNANRIGKNPAEILSTFFDWW 63

  Fly    61 TKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQK 125
            ..|.:..:.   |:..::...|:|:.:.::.:|  :......:...|:.:...|...|.:..|.|
  Fly    64 YDYGKDNFL---FWIGYSSHIVMTNPKQLEYIL--NSQQLIQKSTIYDLLHPWLGHGLLTSFGSK 123

  Fly   126 WRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFS--AKTTTGEGQVLEIVDLV--ARY-TADV 185
            |...|..:||:|....:::...:   :.|...|..:  .|.:.|:    .|:|..  |.| |.||
  Fly   124 WHKHRKMITPSFHFNILQDFHEV---MNENSAKFMTQLKKASAGD----TIIDFQEHANYLTLDV 181

  Fly   186 IGNCAFGLNCNSLQNPNAEFV--------TIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNV 242
            |.:.|.|:..|:::..::..|        .|..||....:....:..|...|....:.|:     
  Fly   182 ICDTAMGVPINAMEQRDSSIVQAFRDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLK----- 241

  Fly   243 QDVEDFYTSIVRNTIDYRLRTNEKRHD-----------FMDSLIEMYEKEQAGNTEDG--LSFNE 294
             .::||...|:...: |.|:....:.|           |:|:|:        .:|.||  |:..|
  Fly   242 -TLQDFTYDIIEKRV-YALQNGGSKEDHDPSLPRKKMAFLDTLL--------SSTIDGRPLTRQE 296

  Fly   295 ILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKH-NNEFTYEGIKEMKYLE 358
            |..:...|...|.:|:::.:.|::|.|:...|:|.:|..|...|:... |...:::.|.:||||:
  Fly   297 IYEEVSTFMFEGHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLD 361

  Fly   359 QVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFT 423
            ..:.|..|.||.:..:.|....|:.....  .:.||||:.:..:.:.|:..|:.:|..|:||||.
  Fly   362 LFIKEAQRVYPSVPFIGRYCDKDYDINGS--IVPKGTTLNLALILLGYNDRIFKDPHHFRPERFE 424

  Fly   424 DEAIAARPS-CTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKF------SVSTETQIPM--- 478
            :|    :|: ..:|||..|||||||.:|.|::....::.::|.::.      .|||:.::..   
  Fly   425 EE----KPAPFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAVDELVSTDGRLNTYLG 485

  Fly   479 --------------KF--VVKSIL-LSAENGIHLKVEK 499
                          |:  ::.::| |.::||:||::.:
  Fly   486 LAPDEKLKREAGRHKYDPILSAVLTLKSDNGLHLRLRE 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 120/514 (23%)
Cyp4e3NP_523527.1 p450 35..468 CDD:278495 111/466 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.