DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and Cyp4ac2

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_608917.3 Gene:Cyp4ac2 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster

Alignment Length:501 Identity:118/502 (24%)
Similarity:199/502 (40%) Gaps:99/502 (20%)


  Fly    40 YGNMKDWPK--KRHIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFEN 102
            :||..|...  ...|....||...|.|...|.   :|||......|...|..:.:|  ..:....
  Fly    57 FGNNFDLVNFTSESIFNFMRDASAKAKGRNYL---WYFFHAPMYNIVRAEEAEEIL--QSSKLIT 116

  Fly   103 RGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSA--KTT 165
            :.:.|..:...|...|.....|||...|..|||.| ..|:...|.||.|  ||..|:...  ::.
  Fly   117 KNMIYELLKPFLGEGLLISTDQKWHSRRKALTPAF-HFKVLQSFLIIFK--EECNKLVKVLHQSV 178

  Fly   166 TGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFP 230
            ..|   ||:..::.::|.:.:...|.|:..:.                                 
  Fly   179 NME---LELNQVIPQFTLNNVCETALGVKLDD--------------------------------- 207

  Fly   231 KLSRRLRLKLNVQDVED---------FYTSIVRNTI--DYRLRTNEKR--HDFMDSLIE----MY 278
             ||..:|.:.::..:|:         |:.:||...:  |||.:.|..:  |:|..::||    ::
  Fly   208 -LSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYFFLFGDYRKQVNNLKIAHEFSSNIIEKRRSLF 271

  Fly   279 EKEQAGNTE-------------------DG-LSFNEILAQAFIFFVAGFETSSTTMGFALYELAL 323
            :..|.|..:                   || :....|..:...|...|::|:||.:.|.|..|||
  Fly   272 KSNQLGQEDEFGKKQRYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLAL 336

  Fly   324 DQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPK 388
            .:|:|.:...|| ..|...:::.:.....|:.|:|.|:.|:||.:|.:..:.|....:.....  
  Fly   337 HEDVQKKCYEEI-KYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVNG-- 398

  Fly   389 YFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLM 453
            ..:.|.|.:.|....|..|...:..|:.|:|:||..|....|....::||..|.|||||.:|.::
  Fly   399 LIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAIL 463

  Fly   454 QACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEK 499
            :..|.||.:||.:|.       :|:..:..   |:.||||.|:.::
  Fly   464 EIKVLLAAVIRNFKI-------LPVTLLDD---LTFENGIVLRTKQ 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 117/496 (24%)
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 118/502 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.