DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and Cyp4ac1

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_608916.1 Gene:Cyp4ac1 FlyBaseID:FBgn0031693 Length:509 Species:Drosophila melanogaster

Alignment Length:429 Identity:107/430 (25%)
Similarity:189/430 (44%) Gaps:67/430 (16%)


  Fly   103 RGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSA--KTT 165
            :.:.|..|...|...|......||...|..|||.|....:::...|.   .||.:|..:.  |..
  Fly   116 KNVVYELIRPFLGDGLLISTDHKWHSRRKALTPAFHFNVLQSFLGIF---KEECKKFLNVLEKNL 177

  Fly   166 TGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPN--AEFVTIGKRAIIERRYGGLL----DF 224
            ..|   ||:..::..:|.:.|...|.|:..:.:...|  .:.:...:..:|:|....|:    .|
  Fly   178 DAE---LELNQVIPPFTLNNICETALGVKLDDMSEGNEYRKAIHAIEEVLIQRVCNPLMYYNWYF 239

  Fly   225 LIFG-FPKLSRRLRLKLNVQDVEDFYTSIV-RNTIDYRLRT--------NEKRHDFMDSLIEMYE 279
            .::| :.|..:.||:      |.||.:.|: |....::.:.        .::|:..:|:|:    
  Fly   240 FVYGDYRKHLQNLRI------VHDFSSRIIERKRQQFQQKQLGEVDEFGRKQRYAMLDTLL---- 294

  Fly   280 KEQAGNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNN 344
               |...:..:....|..:...|...|::|:||.:.|.|..|||.:|:|.:...|:.| |.:.::
  Fly   295 ---AAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEVEN-LPEDSD 355

  Fly   345 EFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTD------FSPEDPKYFIAKGTTVVIPALG 403
            :.:.....::.|||.|:.|:||.:|.:..:.|....:      ..|:|        |.:.|....
  Fly   356 DISMFQFNKLVYLECVIKESLRMFPSVPFIGRQCVEETVVNGMVMPKD--------TQISIHIYD 412

  Fly   404 IHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKF 468
            |..||..:|:|:.|:|:||..|....|....::||..|.|||||.:|.:::..|.||.:||.:|.
  Fly   413 IMRDPRHFPKPDLFQPDRFLPENTVNRHPFAYVPFSAGQRNCIGQKFAILEMKVLLAAVIRNFKL 477

  Fly   469 SVSTETQIPMKFVVKSILLSAENGIHLKVE-----KLSK 502
            ..:|:.:.          |:.||||.|:.:     ||||
  Fly   478 LPATQLED----------LTFENGIVLRTQENIKVKLSK 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 102/416 (25%)
Cyp4ac1NP_608916.1 p450 86..504 CDD:278495 104/426 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.