DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and Cyp4f39

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 MGIID:2445210 Length:532 Species:Mus musculus

Alignment Length:419 Identity:106/420 (25%)
Similarity:189/420 (45%) Gaps:46/420 (11%)


  Fly   106 FYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPII---VKVGEEMEKIFSAK--TT 165
            ||:.:...|...|...:|.||...|..|||.|       .|.|:   :|:..:...|..||  ..
Mouse   132 FYSFLKPWLGDGLLISKGNKWSRHRRLLTPAF-------HFDILKPYMKIFNQCTNIMHAKWRRH 189

  Fly   166 TGEGQV--LEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVT--IGKRAIIERRYGGLLDFLI 226
            ..||.|  .::.:.::..|.|.:..|.|..| :..|...:::::  |...|::.||...|..:|.
Mouse   190 LAEGSVTSFDMFEHISLMTLDSLQKCVFSYN-SDCQERMSDYISSIIELSALVVRRQYRLHHYLD 253

  Fly   227 FGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNT----- 286
            |.:...:...|.:.....|.:|.|.:::          |:|........|.:.|.:.|.|     
Mouse   254 FMYYLTADGRRFRQACDTVHNFTTEVIQ----------ERRQALRQQGAEAWLKAKQGKTLDFID 308

  Fly   287 -------EDG--LSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVL-SK 341
                   |:|  ||..:|.|:|..|...|.:|:|:.:.:||:.||...:.|::.|.||..|: .:
Mouse   309 VLLLAKDEEGKELSDEDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMKGR 373

  Fly   342 HNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHY 406
            ...|..::.:.::.:....:.|:||::|.:..::|....|....|.: .|.||...::...|.|:
Mouse   374 ELEELDWDDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGR-VIPKGIICLVSIYGTHH 437

  Fly   407 DPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVS 471
            :|.::|:.:.:.|.||..:....|....::||..|||||||..|.:.:..|.:|..:..::.||.
Mouse   438 NPIVWPDSKVYNPYRFDPDTPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLSVD 502

  Fly   472 TETQIPMKFVVKSILLSAENGIHLKVEKL 500
            ...::..|   ..::|..|||:.|.||.|
Mouse   503 RTHKVRRK---PELILRTENGLWLNVEPL 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 102/413 (25%)
Cyp4f39NP_796281.1 p450 60..523 CDD:278495 102/413 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.