DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp6a23 and Cyp4f39

Sequence 1:NP_611000.2 Gene:Cyp6a23 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_006226004.2 Gene:Cyp4f39 RGDID:1308796 Length:554 Species:Rattus norvegicus

Alignment Length:551 Identity:135/552 (24%)
Similarity:234/552 (42%) Gaps:96/552 (17%)


  Fly     2 SLLLTLIALLVSLLL----------FMARRRHGYWQRRGIPHDVPHPIYGNMKDW-PKKR----- 50
            :|||.|:.||..|||          ...||...:.:..|     .|.:.|:|..: |.::     
  Rat    26 ALLLFLLFLLFRLLLQAFKLFSDFRITCRRLSCFPEPPG-----RHWLLGHMSMYLPNEKGLQNE 85

  Fly    51 --------HIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVL-----IKDFNHFEN 102
                    ||.:.:          |.||...       .|:...:.:|.||     |...:.|  
  Rat    86 KKVLDTMHHIILAW----------VGPFLPL-------LVLVHPDYIKPVLGASAAIAPKDEF-- 131

  Fly   103 RGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPII---VKVGEEMEKIFSAK- 163
               ||:.:...|...|...:|.||...|..|||.|       .|.|:   :|:..:...|..|| 
  Rat   132 ---FYSFLKPWLGDGLLISKGNKWSRHRRLLTPAF-------HFDILKPYMKIFNQSVNIMHAKW 186

  Fly   164 -TTTGEGQV--LEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVT--IGKRAIIERRYGGLLD 223
             ....||.|  .::.:.|:..|.|.:..|.|..: :..|...:::::  |...|::.||...|..
  Rat   187 RRHLAEGSVTSFDMFEHVSLMTLDSLQKCVFSYS-SDCQEKLSDYISSIIELSALVVRRQYRLHH 250

  Fly   224 FLIFGFPKLSRRLRLKLNVQDVEDFYTSIVRNT--------IDYRLRTNE-KRHDFMDSLIEMYE 279
            :|.|.:...:...|.:.....|.:|.|.:::..        .:..|:..: |..||:|.|  :..
  Rat   251 YLDFIYYLTADGRRFRQACDTVHNFTTEVIQQRRRALRELGAEAWLKAKQGKTLDFIDVL--LLA 313

  Fly   280 KEQAGNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVL-SKHN 343
            |::.|..   ||..:|.|:|..|...|.:|:|:.:.:||:.||...:.||:.|.||..|: .:..
  Rat   314 KDEEGKE---LSDEDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQDKCREEIQEVMKGREL 375

  Fly   344 NEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVI----PALGI 404
            .|..::.:.::.:....:.|:||::|.:..::|....|....|.: .|.||...::    ...|.
  Rat   376 EELDWDDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGR-IIPKGACCLLYCSAGIYGT 439

  Fly   405 HYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFS 469
            ||:|.::|:.:.:.|.||..:....|....::||..|||||||..|.:.:..|.:|..:..::.|
  Rat   440 HYNPLVWPDSKVYNPYRFDPDIPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLS 504

  Fly   470 VSTETQIPMKFVVKSILLSAENGIHLKVEKL 500
            |....::..|   ..::|..|||:.|.||.|
  Rat   505 VDRTRKVRRK---PELILRTENGLWLNVEPL 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 119/501 (24%)
Cyp4f39XP_006226004.2 p450 60..527 CDD:278495 120/511 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126554
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.